SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000016828 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000016828
Domain Number 1 Region: 56-259
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-56
Family DBL homology domain (DH-domain) 0.00019
Further Details:      
 
Domain Number 2 Region: 270-419
Classification Level Classification E-value
Superfamily PH domain-like 6.15e-30
Family Pleckstrin-homology domain (PH domain) 0.003
Further Details:      
 
Domain Number 3 Region: 405-471
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.3e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0023
Further Details:      
 
Domain Number 4 Region: 428-592
Classification Level Classification E-value
Superfamily PH domain-like 1.36e-20
Family Pleckstrin-homology domain (PH domain) 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000016828   Gene: ENSSHAG00000014314   Transcript: ENSSHAT00000016970
Sequence length 606
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856880.1:1447198:1480844:1 gene:ENSSHAG00000014314 transcript:ENSSHAT00000016970 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLWESESLEDKWKPGHRPVSTRLLNSLKNKISSGGWKKPCEVTLCSFPGLEEPEENKIVR
ELLETEQTYVSRLHLLDQVFFEELLKEARSSKAFSEDVVKLIFSNISSIHQFHSQFFLPE
LQRRVKEWAAVPRIGDVIQKLAPFLKMYSEYVKNFERAAELLAIWTEKCPPFQEVITRIQ
NSEVSANLTLQHHMLEPVQRIPRYELLLKEYVEKLPPDAADQADAQKALDMIFSAAQHSN
AAISEMERLQNLWDVYQRLGLEDDIVDPSNELLQEGPIQKISFRHSSTMERYLFLFNNML
LYCVPKVIQVGAQFQVRTRIDVAGMKVRELNDVEFPHSFLVSGKQRTLELQAQSQEEMNT
WIQACQQAIDQIGKRHETFKAAVQGPEGDTEEHQLKSEELGIRAPQWVRDKMVTMCMRCK
TPFNALTRRRHHCRACGYVVCAKCSDYRARLKYDDNRLNRVCLECYVFLTGNLLPEDKED
KKKGILEKESSKVSEQSLMCSFLQLLGDKWGKSSSRGWCVIPRDDPLVLYIYAAPQDMKA
HTSIPLLGYQVTSGPLTDPRAFQLQQSGLVYSFRAESEELRGQWMKAIDRAARGQSFIEP
EGELSD
Download sequence
Identical sequences G3WN23
ENSSHAP00000016828 ENSSHAP00000016828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]