SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000016836 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000016836
Domain Number 1 Region: 1543-1728
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.69e-29
Family Laminin G-like module 0.0016
Further Details:      
 
Domain Number 2 Region: 1370-1538
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.16e-26
Family Laminin G-like module 0.0028
Further Details:      
 
Domain Number 3 Region: 1155-1325
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.39e-21
Family Laminin G-like module 0.011
Further Details:      
 
Domain Number 4 Region: 960-1150
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000317
Family Laminin G-like module 0.012
Further Details:      
 
Domain Number 5 Region: 765-950
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000435
Family Laminin G-like module 0.039
Further Details:      
 
Domain Number 6 Region: 123-171
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000795
Family Laminin-type module 0.0086
Further Details:      
 
Domain Number 7 Region: 215-264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000419
Family Laminin-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000016836   Gene: ENSSHAG00000014321   Transcript: ENSSHAT00000016978
Sequence length 1728
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834662.1:1448995:1478494:1 gene:ENSSHAG00000014321 transcript:ENSSHAT00000016978 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSITFLESSYPAPGDIHRGKVDLVEGNFRHTETNNPVSREELMMVLAGLEQLHIRALFSQ
ISSAVSLQRVVLEVVMDGPGGAQASNVEVCMCPANYRGDSCQECAPGYYRDTKGHFLGKC
IPCHCNGHSDRCLPGSGICVGCQHNTEGDHCERCKDGFVSNATQDQSSSFCISCPCPLSV
PSNNFAVGCVHKGGRCDRCQDGHYGFDSCGGCQPCNCGLGAVGSSCHSQSGQCHCRAGVS
GTQCQQCAPGYWGFNEHGCTRCQCQGGHCDPRTGECTCPPGLSGKQCDSCSHQHQVPVTH
SPGGVHCEVCDSCVVLLLDDLERMESLFPTIRQQLSSLNASSVAWARLHEINSSIAALTN
QLRGPPGSREPTRQRLDELERQSGALEEETSTLHSRAELKSQMDRLSPSNTSTASGEEFL
QTLAEVEQMLQEMRDRDFGGPRNVAEGELGEAQRWSVLNRVQSQLTSQWEESQTLASSIR
ERLAQHSSQLMDLRDALNEAVNKTRLTEELNSRNQEHLEERLQKKKELERENATLRDTLR
MAEDALAQVSELLQTMDRAKEEYERLAANLDGARTPLTEKMQKFSPASSKIPLVERAEEH
ARELDQLAYNLSSIIRSTNQDRFIQRAIEASNAYGSILQAVRQAEEAAGQALHNATSTWE
MVVQEGLSARARELRENSSILEEAVRDQQRRLNGAIRETLQASRTQLEEAKAKKDHLVAQ
LKGVQSMLAMDKDKRGQNASLALSNSILRVRELITQARSAASKVKVPTQFNGRSGVQLRP
PRDLQDLAAYTALKFYIQSSEPPQQQGHNGGSQFILYMGSREASGDYMGVILHEHKVQWV
YRLGEAAHRTLTIDEDIGEHFATVSIDRILQYGHMSVTMEKQMVHETKGDSVYPGDQGLL
NLRAQDFVFYVGGYPSNFTPPRPLRYPGYRGCIEMDTLNEEVVSLYNFQKTFHLDTAVDK
PCARSKSTGDPWLTDGSYLDGTGFAHIHFESQLISTKRFEQELRLVSYNGIIFFLQYQDQ
FLCLAVQEGHLILYYDFSHGLKVATPQQELTPLTSSNKAIQIFIMGVTGRKRILVRVERV
SVFSLQEDNLLENADSYYLGGVPLARLPPSLRSLFPTGGSIRGCVKGLKALGKYVDLKRL
NTTGISSGCTSDLLITRSMTFHGHGYLTLALRDVPPLTGNFYTGFGFRSTQDSGLLYYHA
SPEGIFQVFLRQGRVTLKLLRMEVMTRDAYADGVSHYVAVYSNSTGVWLYVDDRLQVTEP
QGGRSRRQAPAEDPPRFLLGGLPESPAFQNLTGCISNVFVRRVSEAQHVVDLQQNIQNIN
VTTGCALPDEPLQLRVSPRKFRRKPKAALHDQEMPPDFACQFPTHPQTISHAYQFGASPA
SRLEFAPLPFSFQERTHFSMDIQLRSLRGLLLAVPAAKSGSPFLALFLSHGHFILQAGGH
GKPFRVRSREQYKPGGWHTVFFSREQNRIQLVIDGLRAQSSERSRARGKALLGHGPVYVG
GLPSGPSWTHLPEAAGTGFKGCIRNLKMNGQPLETPTQLHGVIPCYTGTLEKGLFFAAQG
GSVVLEHPTTWGPDLELVLEVRPRAAVGLLFHLGSTQGPPYIRLEADGDKVLVRADSGAG
EFSTSVTRPPLCDGLWHRIAVIKGRSMLRLDVDTKGNYTVAPASVPSIITKEPLYLGGLP
ETLKSTVSPSSLPGYYGCIRNLVANRRPVDLTRTGIIQGSVGANGCPV
Download sequence
Identical sequences G3WN31
ENSSHAP00000016836 ENSSHAP00000016836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]