SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000016857 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000016857
Domain Number 1 Region: 204-264
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000153
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 2 Region: 36-77
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000655
Family EGF-type module 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000016857   Gene: ENSSHAG00000014337   Transcript: ENSSHAT00000016999
Sequence length 712
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841492.1:1454677:1583452:1 gene:ENSSHAG00000014337 transcript:ENSSHAT00000016999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCATCHVHATCQQRDGKESCICNYGFVGNGITQCHDKDECQYGATVVCGNKTSCHNTLGG
FYCVCLEGYRATNNNKTFIPNDGTFCTDHVSSRCVCSSLCRCWEKCHEAHKFFYCQCSVR
NRPIWSWDHIYPTLINNCQTSCSSFSPPSPPPSPLDGRMTSRCSSQVSILCHKGYLSGRE
RYIDKASLLKTQERNSYHCQDAEIKCGSPPVIQHAILVGNYSSNLGSIVYYTCVDGFEST
GGNLTSLCTAEGIWKKNTLHCTEKKTSITNVFVFNDTCVKWRVSPGREDLKMAYLIHIQG
QQRDRTEFVHEDLLNFTTSSQEPEVCLHLDQGTNYTVTIRITFPRLSVPVTVRIQTADIS
LYYDDGSLNVSIFNETCLKWKRNPRDIAEKQIYQFQVLGQRQYQNNFYHETSFNFTTRER
FPEVCLDLYPRTYYTINITTMAFPKHSAHIIIATPRSVKQIISNISVLNETCLRWKRNMK
MDDSEEMYLFHIWGRRGYQKEFDQEVSFNLTTGSWAPEVCLELYPGTNYTVNITAASSGL
PVVVSLMTQITEPPIPNIEFIAVQGDPLPALSLRKAEDRNGPISSYQVLVLPLALQSKFL
CDSIQNTTFFTNDSSTKGYVAAEFLAKDITDVQEISLGDRLYYGKFYNAPLKPRSDYCII
LRITSEWNQVHSESLKNKNAIQNISIHFLFMGPGFNIEIVLVIMTLWSASLL
Download sequence
Identical sequences G3WN52
ENSSHAP00000016857 ENSSHAP00000016857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]