SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000017124 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000017124
Domain Number 1 Region: 152-490
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.19e-84
Family Protein kinases, catalytic subunit 0.000000252
Further Details:      
 
Domain Number 2 Region: 1-149
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.38e-42
Family Regulator of G-protein signaling, RGS 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000017124   Gene: ENSSHAG00000014553   Transcript: ENSSHAT00000017266
Sequence length 544
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834624.1:1516855:1533723:-1 gene:ENSSHAG00000014553 transcript:ENSSHAT00000017266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQFPHISLCEDLRQSVERDYHSLCEKQPIGHLLFRQFCETRPELSRCISFLDGVAEYEV
TPDDKRKEAAQRLMENYLNPKCTDHIPEVPSQLVSACAEKLEQGPCKDLFKELTRLTHEY
LSVAPFADYLDSIYFNRFLQWKWMERQPVTKNTFRQYRVLGKGGFGEVCACQVRATGKMY
ACKKLEKKRIKKRKGEAMALNEKQILEKVNSRFVVSLAYAYETKDALCLVLTLMNGGDLK
FHIYHMGEAGFEEARAVFYAAEICCGLEDLHRERIVYRDLKPENILLDDHGHIRISDLGL
AVYVPEGQTMKGRVGTVGYMAPEVVKNERYTFSPDWWALGCLLYEMIEGQSPFQQRKKKI
KREEVERLVKEVAEEYSGKFSSKARSLCTSLLCKDPRERLGCRGGGAQEVKEHPIFKRIN
FKRLEAGMLEPPFKPDPQAIYCKDVLDIEQFSTVKGVELESTDNDFYQKFATGSVPIPWQ
NEMIETECFKELNVFGMDGTVPPDLDWKGLPSPQPKKGLLQRLFSRQDCCGNCSDSEEES
PTRL
Download sequence
Identical sequences G3WNW9
XP_012408324.1.9362 ENSSHAP00000017124 ENSSHAP00000017124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]