SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000017247 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000017247
Domain Number 1 Region: 2-41
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000164
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000017247   Gene: ENSSHAG00000014662   Transcript: ENSSHAT00000017390
Sequence length 183
Comment pep:novel scaffold:DEVIL7.0:GL841393.1:1546644:1559068:-1 gene:ENSSHAG00000014662 transcript:ENSSHAT00000017390 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ADVNECVPPIKIFCGMNADCVNTYGSYHCTCIPGYALPSGEKNFPNASMNNCQEVKTPGY
ISKLSQNPELKNLSYKLQSFIAINTNWTAENKRRIAIEVTELLQNLEQTAWQDALRSPVK
KWMLLNNSRVGIETRVISNCSQEEKDVILQAQNNAVKFSCMDIIGSNPQDIIYHTISLIS
FLH
Download sequence
Identical sequences G3WP92
ENSSHAP00000017247 ENSSHAP00000017247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]