SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000017305 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000017305
Domain Number 1 Region: 343-585
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.25e-78
Family Eukaryotic proteases 0.0000671
Further Details:      
 
Domain Number 2 Region: 191-295
Classification Level Classification E-value
Superfamily Kringle-like 2.42e-32
Family Kringle modules 0.00045
Further Details:      
 
Domain Number 3 Region: 29-83
Classification Level Classification E-value
Superfamily Kringle-like 2.86e-19
Family Fibronectin type II module 0.0027
Further Details:      
 
Domain Number 4 Region: 89-125
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000617
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000017305   Gene: ENSSHAG00000014710   Transcript: ENSSHAT00000017450
Sequence length 587
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834624.1:1557708:1570771:1 gene:ENSSHAG00000014710 transcript:ENSSHAT00000017450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHFLLLFGALLMGLRLALMAPPWKTPKELMTIAVITSGDPCHFPFQYRGHLYHKCIKRGR
PGPHAWCATTNNYDRDQQWVYCLEFKKVKDHCKHHLCQEGGTCINTFRGAHCLCAPHLTG
QHCQKEKCYEPQLRQFFDENETWLRAEPQRVAKCWCKGPTADCKWLPNSQVCLDNPCLHG
GKCLEAEGQSVCHCPPSYAGHFCEIDTSAKCYNGRGLTYRGTAQTTLSGKQCQPWSSEVT
FRDLSREQVLTKGLGHHPYCRNPDNDTRPWCYVLSGIRMSWEYCSLAICQHPTQNPTIES
QHPTTPAPSSFTELSRESLASQSPQWNVNSVACGQRQKKRLSRLNRVVGGLVALPGAHPY
IAALYLDQKFCAGSLFSACWVLTAAHCLENRPAPELLKVVLGQERFNESCPHCQEFSVRE
YRVHESFRDDTFQHDIALVRLQETKDGGCARFSPFVQPVCLPESPEPPGEALSCQVAGWG
HQYEEAEDYSSYLQEAQLPIIPHDRCSAQDMHGQAVTQDMLCAGFLEGGTDACQGDSGGP
LVCEEKAGQLTLRGVVSWGVGCGKRNKPGVYANVASYLGWIREHTVS
Download sequence
Identical sequences G3WPF0
XP_012408189.1.9362 ENSSHAP00000017305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]