SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000017306 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000017306
Domain Number 1 Region: 349-596
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.79e-75
Family Eukaryotic proteases 0.0000671
Further Details:      
 
Domain Number 2 Region: 197-301
Classification Level Classification E-value
Superfamily Kringle-like 2.42e-32
Family Kringle modules 0.00045
Further Details:      
 
Domain Number 3 Region: 42-89
Classification Level Classification E-value
Superfamily Kringle-like 1.34e-18
Family Fibronectin type II module 0.0027
Further Details:      
 
Domain Number 4 Region: 95-131
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000641
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000017306   Gene: ENSSHAG00000014710   Transcript: ENSSHAT00000017451
Sequence length 598
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834624.1:1558431:1570291:1 gene:ENSSHAG00000014710 transcript:ENSSHAT00000017451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHFLLLFGALLMGLRLALMAPPWKTPKELMTIAVSPPVTVITSGDPCHFPFQYRGHLYHK
CIKRGRPGPHAWCATTNNYDRDQQWVYCLEFKKVKDHCKHHLCQEGGTCINTFRGAHCLC
APHLTGQHCQKEKCYEPQLRQFFDENETWLRAEPQRVAKCWCKGPTADCKWLPNSQVCLD
NPCLHGGKCLEAEGQSVCHCPPSYAGHFCEIDTSAKCYNGRGLTYRGTAQTTLSGKQCQP
WSSEVTFRDLSREQVLTKGLGHHPYCRNPDNDTRPWCYVLSGIRMSWEYCSLAICQHPTQ
NPTIESQHPTTPAPSSFTELSRESLASQSPQWNVNSVACGQRQKKRLSRLNRVVGGLVAL
PGAHPYIAALYLDQKFCAGSLFSACWVLTAAHCLENRPAPELLKVVLGQERFNESCPHCQ
EFSVREYRVHESFRDDTFQHDIDFWGLALVRLQETKDGGCARFSPFVQPVCLPESPEPPG
EALSCQVAGWGHQYEEAEDYSSYLQEAQLPIIPHDRCSAQDMHGQAVTQDMLCAGFLEGG
TDACQGDSGGPLVCEEKAGQLTLRGVVSWGVGCGKRNKPGVYANVASYLGWIREHTVS
Download sequence
Identical sequences G3WPF1
ENSSHAP00000017306 ENSSHAP00000017306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]