SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000017366 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000017366
Domain Number 1 Region: 268-590
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.46e-90
Family p120GAP domain-like 0.0000332
Further Details:      
 
Domain Number 2 Region: 142-252
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000129
Family Synaptotagmin-like (S variant) 0.066
Further Details:      
 
Domain Number 3 Region: 69-141
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000221
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000017366   Gene: ENSSHAG00000014756   Transcript: ENSSHAT00000017511
Sequence length 1104
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856754.1:1568722:1732360:1 gene:ENSSHAG00000014756 transcript:ENSSHAT00000017511 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAANTSPFKVPGFFSKRLKGSIKRTKSQSKLDRNTSFRLPSLRNTDDRSRGLPKLKESR
SHESLLSPCSAVECLDLGRGEPVSVKPLHSSILGQDFCFEVTYLSGSKCFSCNSASERDK
WMENLRRTVQPNKDNCRRAENVLRLWIIEAKDLAPKKKYFCELCLDDTLFARTTSKTKAD
NIFWGEHFEFYSLPPLHSITVHIYKDMEKKKKKDKNNYVGLVNIPTASVTGRQFVEKWYP
VSTPTPNKGKTGGPSIRIKSRFQTITILPMEQYKEFAEFVTSNYTMLCSVLEPVISVRNK
EELACALVHILQSTGRARDFLTDLVMSEVDRCGEHDVLIFRENTIATKSIEEYLKLVGQQ
YLHDALGEFIKALYESDENCEVDPSKCSSSELFDHQSNLKMCCELAFCKIINSYCVFPRE
LKEVFASWKQQCLNRGKQDISERLISASLFLRFLCPAIMSPSLFSLMQEYPDDRTSRTLT
LIAKVIQNLANFAKFGNKEEYMAFMNDFLEHEWSGMKRFLLEISNPDTISNTPGFDGYID
LGRELSVLHSLLWEVVSQLDKATVAKLGPLPRVLADITKSLTNPTPIQQQLRRFTEHNSS
PNVSGSLSSGLQKIFEDPTDSELHKLKSPTQENTDSYFRGKTLLLVQQASSQSMTYSEKD
EKENGLPNGRSISLMDLQDPHAAQMDHTSIMLDVPMRLTGSQLSITQVASIKQLRETQST
PQSAPQVRRPLHPALSQPGSLQPLSFQNPVYHLNNPTPSMPKASVDSSLENLSTASSRSQ
SNSEDFKLSGPSNSSLEDFAKRSTQSEDFSRRHTGPDRHIPLALPRQNSTGQAQIRKMDQ
AGLGARAKGPHSLPHSASLRSTGSMSVASAALVAEPVQNGSRSRQQSSSSRESPVPKVRA
IQRQQTQPVQSPVDSATMSPVERTAAWVLNNGQYEEDEDDTEQNQDDVKHAEKYEQEIAK
LKERLKVSSRRLEEYERRLLVQEQQMQKLLMEYKARLEDSEERLRRQQEEKESQMKSIIS
RLMAVAKVTGKNTDNWWGGCGAKQKIIDAQEKRIVSLDSANTRLMSALTQVKERYSMQVR
NGISPTNPTKLSITENGEFKNSSC
Download sequence
Identical sequences G3WPL1
ENSSHAP00000017366 ENSSHAP00000017366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]