SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000017414 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000017414
Domain Number 1 Region: 567-1043
Classification Level Classification E-value
Superfamily Ras GEF 3.27e-142
Family Ras GEF 0.0000000000000162
Further Details:      
 
Domain Number 2 Region: 8-177
Classification Level Classification E-value
Superfamily Histone-fold 2.72e-55
Family TBP-associated factors, TAFs 0.000000132
Further Details:      
 
Domain Number 3 Region: 198-400
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.22e-42
Family DBL homology domain (DH-domain) 0.00000000428
Further Details:      
 
Domain Number 4 Region: 418-572
Classification Level Classification E-value
Superfamily PH domain-like 1.05e-38
Family Pleckstrin-homology domain (PH domain) 0.000000458
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000017414   Gene: ENSSHAG00000014797   Transcript: ENSSHAT00000017559
Sequence length 1316
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834746.1:1584573:1759793:1 gene:ENSSHAG00000014797 transcript:ENSSHAT00000017559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQALQLQYEFFSEENAPKWRGLLVTALKKVQMQVHPTLASNEDALQYVEELILQLLSMLC
QAQPRSVLDVEDRVQKSFPHPIDKWAIADAQSANEKRKRRNPLSLPVEKIHPLLKEVLGY
KIDHQVSVYIVAVLEYISADILKLVGNYVRNIRHYEITKQDIKVAMCADKVLMDMFHQDV
EDINILSLTDEEPSTSGEQTYYDLVKGFMAEVRQYIRELNLIIKVFREPFVSNSKLFSSH
DVENIFSRIADVHELSVKLLGHIEDTVEMTDEGSPHPLVGSCFEDLAEELAFDPYESYAQ
DILRPGFHDHFLSQLSKPGAALYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELLKQL
EEKSEDQEDKECLKQAITALLNLQSSMERICSKSLAKRRLSESACRFYSQQMKGKQLAIK
KMNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGQPRL
PGASNAEYRLKEKFFMRKVQINDKDDTNEYKHAFEIILKDENSVIFSAKSAEEKNNWMAA
LISLQYRSTLERMLDVTMLQEEKEEQMRLPSSDLYRFAEPDSEENIVFEENMQPKSGIPI
IKAGTVIKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLLIERFEIPEPEPTEADK
IAMENGDQPLSVELKRFRKEYIQPVQLRVLNVCRHWVEHHFYDFERDTDLLQRLEEFIGT
VRGKAMKKWVESITKIIQRKKMARDNGPGHNITFESSPPAVEWHISRPGHTETFDLLTLH
PIEIARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIV
EAENLEERVAVVSRIIEILQVFQELNNFNGVLEVVSAMNSSPVYRLDHTFEQIPSRQKKI
LEEAHELSEDHYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNPEVLKRHGKELINFSK
RRKVAEITGEIQQYQNQPYCLRVESDIKRFFENLNPMGNSMEKEFTDYLFNKSLEIEPRN
PKPLPRFPKKYSYPLKSPGVRPSNPRPGTMRHPTPLQQEPRKISYSRIPESETESAASAP
NSPRTPLTPPPASGASSTTDVGSVFDSEHSSPFHSRSASVSSINLTKSIDEMPIPPPVPP
RRRPESAPAESSPSKIMPKHLDSPPAIPPRQPTSKVYSPRYSDRTSISDPPESPPLLPPR
EPVRTPDVFSSSPLHLQPPPLGKKSEHGNTFFPNSPSPFTPPPPQTPSPHGTRRHLPSPP
LTQDVDLHSIPAPPVPPRQSTSQHIPKLPPKTYKREHTHPSMHRDGPPLLENAHSS
Download sequence
Identical sequences G3WPQ9
XP_003758384.1.9362 ENSSHAP00000017414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]