SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000017623 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSHAP00000017623
Domain Number - Region: 9-34
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0141
Family EGF-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000017623   Gene: ENSSHAG00000014963   Transcript: ENSSHAT00000017768
Sequence length 42
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841589.1:1640154:1640279:1 gene:ENSSHAG00000014963 transcript:ENSSHAT00000017768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SIVIGKWWCEMEPCLEGEECKTLPDNSGWMCATGNKIKTTRV
Download sequence
Identical sequences D2HPQ9 G3WQB8
ENSAMEP00000019547 ENSAMEP00000019547 ENSSHAP00000017623 ENSSHAP00000017623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]