SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000017634 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000017634
Domain Number 1 Region: 59-189
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.2e-37
Family Regulator of G-protein signaling, RGS 0.00012
Further Details:      
 
Domain Number 2 Region: 362-463
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.96e-31
Family Ras-binding domain, RBD 0.00017
Further Details:      
 
Domain Number 3 Region: 307-375
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.96e-19
Family Ras-binding domain, RBD 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000017634   Gene: ENSSHAG00000014973   Transcript: ENSSHAT00000017779
Sequence length 580
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834624.1:1642560:1669112:-1 gene:ENSSHAG00000014973 transcript:ENSSHAT00000017779 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGKAKHLGVPNGRMVLAVSDGELSNVAGAEGAGEGRGSTLSVHSLPSGPSSPFTSEEQP
VASWALSFERLLQDPLGLAYFTEFLKKEFSAENLSFWKACEQFQQIPASDTQQLAQEARC
IYEEFLSSQALNPVNIDRQAWLGEEVLATPNPDMFRVQQLQIFNLMKFDSYARFVKSPMY
RECLLAEAEGRPLCEPGTSDPGSPNTTFRKKPKLKPGKSLPLGVEDLGQLPNTEAFGGRG
PRKSFRRELGTTNGNPALRRESQGSLNSSASLDLGFLAFVSSKSETQSHRKSLGGPEGEG
ESRVGRYCCVYLPDGTASLALVRPGLTIRSMLASICEKRGLSLPDIKVYLVGNEQKALVL
DQDCTVLADQEVKLENRISFELEIIPLGKVVRITSKSSKRLKEALFPILGKHGLSLQQIS
VYLSGEKRTLDLEKLVSSVSAQRLVLDTLPGVKITRTESTSPSQSQGGPLQTEGKTSQPS
SLLTNSLGQGPRSTGKRHTCDIEGLVELLNRVQSSRADDQRGLLRKEDLVLPDFLQLPVQ
QPSLPEEQPHGEAPQSPPPQTEPPPPAQGDPAESSASPAL
Download sequence
Identical sequences G3WQC9
ENSSHAP00000017634 ENSSHAP00000017634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]