SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000017671 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000017671
Domain Number 1 Region: 191-526
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.34e-80
Family Protein kinases, catalytic subunit 0.00000153
Further Details:      
 
Domain Number 2 Region: 39-186
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.21e-37
Family Regulator of G-protein signaling, RGS 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000017671   Gene: ENSSHAG00000015004   Transcript: ENSSHAT00000017817
Sequence length 565
Comment pep:known_by_projection scaffold:DEVIL7.0:GL849842.1:1653423:1670764:-1 gene:ENSSHAG00000015004 transcript:ENSSHAT00000017817 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFGSLETVVANSAFIAARGSFDASGSSHLARDKKYFSKLKLPPLSKCESLRNTLNLDFE
NICSEQPIGKRLFQQFLKNEEQHVPAVELWRDIEDYDTADNDFRLQKAQAILAGYLDPNA
KLFCSFLEEGMIEKVKEKHSSIPNGLFQPLLQATLGYLSEAPFREYLESLYFMRFLQWKW
LEAQPIGEDWFLDFRVLGKGGFGEVSGCQMKASGKMYACKKLNKKRLKKRKGYQGAIVEK
RILSKVHSRFIVSLAYAFETKTDLCLVMTIMNGGDLRYHIYNVNEENPGFEEARAIFYIA
QIICGMEHLHQKRIVYRDLKPENVLLDNDGNVRISDLGLAVELKEGETKTKGYAGTPGFM
APELLQSEEYDFSVDYFALGVTLYEMIAARGPFRARGEKIENKELKQRIISDPVTYSEKF
SKASKDFCEGLLEKNPEKRLGFKNGNCDELRANVLFKDINWRQLEAGTLEPPFIPDSRTV
YAKNIQDVGAFSTVKGIVFDKTDTEFFQEFATGNCPIPWQEEMIEMGIFGDLNVWRADGQ
MPDDMKGTAVEEPSSSSKSGMCLIS
Download sequence
Identical sequences G3WQG6
XP_003765754.1.9362 ENSSHAP00000017671 ENSSHAP00000017671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]