SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000017776 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000017776
Domain Number 1 Region: 1348-1463
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.85e-36
Family Spermadhesin, CUB domain 0.00028
Further Details:      
 
Domain Number 2 Region: 885-999
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.23e-35
Family Spermadhesin, CUB domain 0.00026
Further Details:      
 
Domain Number 3 Region: 1122-1233
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.8e-35
Family Spermadhesin, CUB domain 0.00069
Further Details:      
 
Domain Number 4 Region: 1010-1117
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-33
Family Spermadhesin, CUB domain 0.00044
Further Details:      
 
Domain Number 5 Region: 542-653
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.81e-33
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 6 Region: 660-768
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.97e-31
Family Spermadhesin, CUB domain 0.00093
Further Details:      
 
Domain Number 7 Region: 1236-1344
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-28
Family Spermadhesin, CUB domain 0.00065
Further Details:      
 
Domain Number 8 Region: 777-881
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.28e-28
Family Spermadhesin, CUB domain 0.00086
Further Details:      
 
Domain Number 9 Region: 423-538
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-24
Family Spermadhesin, CUB domain 0.0018
Further Details:      
 
Domain Number 10 Region: 1467-1521
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.11e-17
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 
Domain Number 11 Region: 6-47
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000197
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 12 Region: 372-411
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000616
Family EGF-type module 0.011
Further Details:      
 
Domain Number 13 Region: 333-374
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000436
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 14 Region: 242-300
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000142
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000017776   Gene: ENSSHAG00000015092   Transcript: ENSSHAT00000017922
Sequence length 1521
Comment pep:known_by_projection scaffold:DEVIL7.0:GL861686.1:1683111:1809531:1 gene:ENSSHAG00000015092 transcript:ENSSHAT00000017922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QTVQRKVCSSNPCQNGGTCLNLLDSFFCLCPHNWKGPVCSADVNECEIYAGTPLSCQNGG
TCFNTAGSYSHGVKGHSPFPSLLNLSHHGAFLGIHQLQGSSFGTLVRKSLKTLWEMGMGF
MIVNSLKDMVLYKCYCTCRPENYGPQCASAHNDCHQGSKALCGNGICEDLDREQMEVPKY
RCLCDAGWKAEPHGVACVDDIDECSLPDPPCSQDPLVECINTQGSFYCGACPIGWKGNGY
RCQDIDECETDNGGCSVVPMVQCINTAGSYHCGSCPPGYQGNGKVCTEINVCLENNGDCH
PNAVCTPGPGCVIPTCTCQPGYTGHGYGPNGCVPLSHICLTSPCVNGECIETVSGYHCKC
NPGWEGINCTENINECLSTPCFNGGTCTDGINGYTCECTSSWTGSQCQTPQQGLSLEKNS
FMPGSCGGLLSGLRGSFSYPNLQFFEYNSNVNCFWIVRTEERKVLRVTFPYFQLDSRDSC
HNQFLQIHDGDSSGAHPLGKYCGSSHPSELISSNNALYFYFHSNLPVNEKVFTVRWETQQ
PECGGLLTGTYGSINSPGYPGNYPPNRDCIWIITTSPGLVLTFAFGTLSLEHHTNSSEDY
LEIRDGPLSHDPVLRKFYSTLSVPPLETTGPFAWIHFHSDSVGSDRGFHITYVTSLVDSE
CGGNYTDAEGTLISPDWPNSYIHNRQCLYIITQPPGERIHLNFTHVELDGWSHCSQSSIE
VRDDETLLEKLCDSKIPVSVYSISNSIWIRFKSALSVQKASFLAFYQVACGGELTGEGTI
RTPFYPNVYPHEKTCYWKITQPQGQVIILNFTDFWIDSSANCDTDYLEIGNSLSMDPSQT
TKYCGLDVPGLVPSIYNIVYIRFRKSASSTNYGFLAQYSATNLACGEILTAPSGSFTSPG
HPNIYPHGVNCTWLISVQTGYRIRLSFLKFHLDFHYNCTSDYLEVFDSGTKTTLGSLVNR
YCGKSVPPSIMSSSNILMLRLVTDADIAYEGFSVTYTSIDASKACLEDYTSQFGFLYSPN
FPSNYPNNAECIYTISVERGHQIALNFANFSLEDPIGLVCIADYVEVKDGGHENSLSLGK
HCGTDKPPMIISHSNKLWIKFKSDSFETHSGFFAYWDASLTGCGGNLTTPVGTFMSPNYP
MPYYHNSECFWLLKSSRGSQFELTFQKFHLESHPNCSSDYLAVYDGLTEDANLLAKLCGN
EIPPLIRSSGDSMFIKLRTDEKQEGGGFLAEYAQTCQDVVIANLSHGVLESINYPNPYFK
AQNCNWTIEVTAGNTINYTFLAFELEDDENCTVDYLELYDGPQLIGRYCGAELPPPGSTT
GSKLHVIFCTDWLGHNEMGFQMSWNLNGCGGELTGPSGFFTSPQYPEKYPPNKECIWYIH
TAPGSSIQLTIEDFDVEHHSNCRFDVLEVYGGPDFDSPRVAQLCSSRSRENPLQVSSAGN
SIAVRFKTDSSINGRGFNASWLEIPDGCGGIFQASSGEIHSPNYPRSYRSNTDCSWLIQV
DRNHHILLNFTDVDFELQDAC
Download sequence
Identical sequences G3WQS1
ENSSHAP00000017776 ENSSHAP00000017776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]