SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000017826 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000017826
Domain Number 1 Region: 410-700
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.83e-80
Family Eukaryotic proteases 0.00029
Further Details:      
 
Domain Number 2 Region: 29-143
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-33
Family Spermadhesin, CUB domain 0.0000178
Further Details:      
 
Domain Number 3 Region: 189-301
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-28
Family Spermadhesin, CUB domain 0.0000171
Further Details:      
 
Domain Number 4 Region: 306-375
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000292
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 5 Region: 139-187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000109
Family EGF-type module 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000017826   Gene: ENSSHAG00000015135   Transcript: ENSSHAT00000017972
Sequence length 703
Comment pep:known_by_projection scaffold:DEVIL7.0:GL849918.1:1699121:1773543:1 gene:ENSSHAG00000015135 transcript:ENSSHAT00000017972 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPSLSSRAFLLCCSLYVCLLRAAANIVELNDMFGEIQSPNFPDSYPSDSEVTWNITVPEG
FRIKLYFMHFDLESSYLCEYDYVKVEAEDQVLALFCGRETTDTEQAPGQQVVLSPGPFMA
LTFRSDFSNEERFTGFDAHYMAVDVDECTEKSDEELACDHYCHNYIGGYYCSCRIGYILH
TDNRTCRVECSDNVFTQRTGVITSADFPGPYPKSSDCLYRIELEDGFAITLLFEESFDVE
DHPEVSCPYDYIKIKAGQKEFGPYCGEKSPGRIDTQSNSVQILFHSDNSGENGGWRLSYT
STGNPCPGLQPPANGKLDPLQAKYTFKDQVLIICDLGYKVIKDNLEMDTFQIECLKDGTW
SNKIPPCKIVDCSTPTELEHGHVTFATRNNLTTYKSQVHYSCQKPYYTLFPNVTGTYTCE
AQGVWMHRELGRKLPTCLPVCGRPKFSNQLLSRTVSGRPAQRGTSPWIAMLLTDGRPFCG
GALLGNRWIVTAAHCLHQPLEFESAPLTSADHLPLADIRVILGKHMTQKKDATEQQFRAK
SVTFHPSYKAATLENDLALIELLEEPVLNDYVMPICLPEEPPQEGTMVLVSGWGKQPLNR
LPEFLMEIEVPIVSREVCQKAYSNIHRRVTGDMVCAGEREGGKDACSGDSGGPMVTRDKE
RSRWYLVGTVSWGDGCGKSNRYGVYSSVHENRAWIQEVTRVQN
Download sequence
Identical sequences G3WQX1
ENSSHAP00000017826 ENSSHAP00000017826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]