SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000017892 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000017892
Domain Number 1 Region: 32-87
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000000000000549
Family Tudor domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000017892   Gene: ENSSHAG00000015189   Transcript: ENSSHAT00000018040
Sequence length 199
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834464.1:1716581:1728625:1 gene:ENSSHAG00000015189 transcript:ENSSHAT00000018040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVIELTKDLLSTQPSETLASSDSFASAQPTHSWKVGDKCMAVWSEDGQCYEAEIEEIDE
ENGTAAITFAGYGNAEVTPLLNLKPVEEGRKAKEDSGNKPMSKKEMIAQQREYKKKKALK
KAQRIKELEQEREDQKVKWQQFNNRAYSKNKKGQVKRSIFASPESVTGKVGVGTCGIADK
PMTQYQDTSKYNVRHLMPQ
Download sequence
Identical sequences G3WR37
XP_007479094.1.35504 XP_012396746.1.9362 XP_020843660.1.61212 ENSSHAP00000017892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]