SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000017893 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000017893
Domain Number 1 Region: 71-126
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000000000000752
Family Tudor domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000017893   Gene: ENSSHAG00000015189   Transcript: ENSSHAT00000018041
Sequence length 238
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834464.1:1716581:1728625:1 gene:ENSSHAG00000015189 transcript:ENSSHAT00000018041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEDLAKQLASYKAQLQQVEAALSGNGENEDLLKLKKDLQEVIELTKDLLSTQPSETLAS
SDSFASAQPTHSWKVGDKCMAVWSEDGQCYEAEIEEIDEENGTAAITFAGYGNAEVTPLL
NLKPVEEGRKAKEDSGNKPMSKKEMIAQQREYKKKKALKKAQRIKELEQEREDQKVKWQQ
FNNRAYSKNKKGQVKRSIFASPESVTGKVGVGTCGIADKPMTQYQDTSKYNVRHLMPQ
Download sequence
Identical sequences F6ZET6 G3WR38
ENSSHAP00000017892 XP_001368587.1.35504 XP_003755438.1.9362 XP_020843658.1.61212 XP_020843659.1.61212 ENSMODP00000013212 ENSSHAP00000017893 ENSMODP00000013212 13616.ENSMODP00000013212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]