SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000017965 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000017965
Domain Number 1 Region: 434-470
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000427
Family Ovomucoid domain III-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000017965   Gene: ENSSHAG00000015251   Transcript: ENSSHAT00000018113
Sequence length 504
Comment pep:known_by_projection scaffold:DEVIL7.0:GL861612.1:1732392:1742117:-1 gene:ENSSHAG00000015251 transcript:ENSSHAT00000018113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTRPCVCLSPPAAILLAPTPAPFPAPGPDVSGAPLSPAEYERFFSALTPIWKAEIACRLR
ATQGCQNHKLVQLDQYENHGTLPQGSVCTDLPFASWFESFCQFTQYRCANRLYYAKRVLC
FPSPSLLSSPETFTRMDSTTVPFSLPHVTTGELPQAAMKISISSPVRENDASLPFSMAAE
KVRPETYLPWSEQIYTDVKDLLQSSLSMEKKGSKARIESPTPPSTRQVRKKHFHPAVIEG
IRELIRSAQVLGSQNKITQVDEDDSFERSPHISSSGLLSLPGEEALLVLCYTILSGSCPA
IPMTKAWQHIEEQIYGFGNTVCDSFGRRHLETCQHCAFCSLKLEQCQSEVPLMREPCSEN
HMEEFLSPLLSAQDTTLGIEVGPRMEGQYYGLDLYGGLGMDFWCGQLATKGCEDTRVSNW
LQTEFLSFQDGDYPYKICDSDYIQYPNYCAFKSHQCLLRNQDKKVFRMRCLKNETYSVLN
VAKGEEAILLWSQKFSSLSLGHGG
Download sequence
Identical sequences G3WRB0
ENSSHAP00000017965 ENSSHAP00000017965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]