SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000017982 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000017982
Domain Number 1 Region: 9-113
Classification Level Classification E-value
Superfamily UBC-like 9.71e-35
Family UEV domain 0.00000215
Further Details:      
 
Domain Number 2 Region: 292-352
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 4.9e-21
Family VPS23 C-terminal domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000017982   Gene: ENSSHAG00000015267   Transcript: ENSSHAT00000018131
Sequence length 359
Comment pep:known_by_projection scaffold:DEVIL7.0:GL864878.1:1736809:1806474:1 gene:ENSSHAG00000015267 transcript:ENSSHAT00000018131 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIKIFVSFLLVFNDGNSRELMSLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPT
SSMTIKTGKHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGEEPPVFSRPTVSASYP
PYQATGPPNTSYMPGMPSGMTPYPPGHPPNPSGFPGYPYPPGGQYPPTTSSQYPSQPPVT
TVGPSRDGTISEDTIRASLISAVSDKLRWRMKEEIDRAHAELNALKRTEEDLKKGHQKLE
EMVTRLDQEVAEVDKNIELLKKKDEELSSALEKMENQSENNDIDEVIIPTAPLYRQILNL
YAEENAIEDTIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDLY
Download sequence
Identical sequences G3WRC7
ENSSHAP00000017982 ENSSHAP00000017982 XP_012407905.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]