SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000018038 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000018038
Domain Number 1 Region: 2-66
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 9.59e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000018038   Gene: ENSSHAG00000015314   Transcript: ENSSHAT00000018187
Sequence length 188
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834583.1:1753963:1770337:-1 gene:ENSSHAG00000015314 transcript:ENSSHAT00000018187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPRCMQCDIKFDFITRKHHCRRCGKCFCDKCCSKKVPLPRMCFVDPVRQCAECVLVSQKE
MEFYDKQLKVLMNGATFSVTLGTSEESELMVCRLSNNQRYLFLDGDSHYEIEIAQISTVQ
ILTEGFTPGGGNTRATGMLLQYKEPGAQDVTQMKFTASEDSNSNKKQSATWLAAMHKAAK
LLYESRDQ
Download sequence
Identical sequences G3WRI3
ENSSHAP00000018038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]