SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000018065 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000018065
Domain Number 1 Region: 53-180
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.57e-46
Family Regulator of G-protein signaling, RGS 0.00000801
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000018065   Gene: ENSSHAG00000015337   Transcript: ENSSHAT00000018214
Sequence length 181
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856748.1:1760224:1842497:-1 gene:ENSSHAG00000015337 transcript:ENSSHAT00000018214 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCKGLAALPHSCLERAKEIKTKLGTLLQKPDTTIDFIIPYPDKPEKPVKTQKPSPEEALQ
WRDSLEKLLQNNYGLASFKSFLKSEFSEENIEFWIACEDYKKIKSPIKMVEKAKKIYEEF
IQTEAPKEVNIDHFTKAVTMKNLVEPSPSSFDMAQKRIHALMEKDSLPRFIRSEFYQELI
K
Download sequence
Identical sequences G3WRL0
ENSSHAP00000018065 ENSSHAP00000018065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]