SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000018108 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000018108
Domain Number 1 Region: 260-434
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.41e-25
Family DBL homology domain (DH-domain) 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000018108   Gene: ENSSHAG00000015372   Transcript: ENSSHAT00000018257
Sequence length 832
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834746.1:1769421:1818300:-1 gene:ENSSHAG00000015372 transcript:ENSSHAT00000018257 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KFFISTGENEIMPVNSPSTQIYQLQALASELKTGFTEAMQELSRIQHGEYALEEKVKSCR
CTMEERVSEMKNSLNYFKEELSNAMSMIQAITTKQEEMQQKIEQLQQEKRRESRKVKTKK
TQKEEHVSPAGAAPNQGSPFRSINIPEPVLTSEDFTNILPTQAYEKVPESRPVHAGDSNV
KGIMSPGVNAATPETEENLKSCLSTEVQTKGPLTPGLWRQPKDSKEWSEEYGSKDHPDKP
KEAAQGRHSSLENVLCETSLSAKRQTVALELLESERKYVINISLVLKIKATFQGSDGKRS
TKERSLFPGSLRYLVQQHLDLLHALQERVLKWPRQGVLGDLFLKLTNDENNFLDYYVAYL
RDLPECISLVHVVVLKEAEEEIKSDLYTLFFHIVQRIPEYLIHLQNVLKFTEQEHPDYYL
LLVCVQRLRVFISHYTLLFQCNEDLLIQKRKKLKKSSMAKLYKGLASQCANTGQDASPAP
GPEAVRDSGGIHSEEMLQPYPASASPGSAVTHLMPQAKKSQPQTLMENLQPGKPCDWELE
GRKHERPESLLAPAQFCGPEQDLKALAAPLQAIPEMDYDSALPDPVANLDRALRAPAELL
TDSRPFVPSYEEFEYGGEIFTLPAPYEEETFQSLPLFEACSPASSESSLDICFLRPVSFT
MEAERTEHSVQPLPKSSTSPVSSSTYKHEAVHGKTKPLSRSLKEFPRTSTSEGVTPRLYS
TRSSSGGRVQLKQERAAQPHIASATARSSPRNFFPPQRTQSEKQTYLEEIHVEDNTRFCP
KEERESEQTSFSDQHPSRQDQKGGFRSSFRKLFKKKNGNEAGEDFCGPWGWW
Download sequence
Identical sequences G3WRQ3
ENSSHAP00000018108 ENSSHAP00000018108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]