SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000018177 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000018177
Domain Number 1 Region: 302-447
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.06e-22
Family Regulator of G-protein signaling, RGS 0.0045
Further Details:      
 
Domain Number 2 Region: 550-657
Classification Level Classification E-value
Superfamily PX domain 2.62e-21
Family PX domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000018177   Gene: ENSSHAG00000015431   Transcript: ENSSHAT00000018327
Sequence length 911
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856917.1:1791618:1933450:-1 gene:ENSSHAG00000015431 transcript:ENSSHAT00000018327 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNINLLKYYASQLDDCANEARYLHILMIFWSFVAGVVTFYCSLGPDTLLPNIFFTIKYKP
KHLELQELFPQGHSCAVCGKVKCERHRPTLLLENYQPWLDLKVSSKVDASLSEMLELVLE
NFVYPWYRDVTDDESFVDELRITLRFFASVLVRRIHKVDIPAVITKKLLKAAMKHIEMIS
KANQKVKNAEFLQQAALEEYGPELHVALRSRRDELHYLRKLTELLFPYILPPKATDCRSL
TLLIREILSGSVFLPSLDFLADPDTVNHLLIIFIDDSPPEKATEPASSLVPFLQKFAEPR
NKKPSVLKLELKEIREQQDLLFRFMNFLKQEGAVHVLQFCLTVEEFNDRILRPELSNDEM
MSLHEEVKKIYKTYCLDESIDKIRFDPFIVEEIQRIADGIYIDVVKLQTMRCLFEAYEHV
LSLLENVFTPMFCHSDEYFRQLLRGAESPTRNSKFNRSTQKRGESFGISKIGSKIKGVFK
STTMEGAMLPNYGLTEGEDDFIEEGIVVMEDDSPVEAVSTPSTPRNLAAWKISIPYVDFF
DDPSSTDRKEKKERIPVFCIDVERNDRRAVGHEPEHWSVYRRYLEFYVLESKLTEFHGTF
PDAQLPSKRIIGPKNYEFLKSKREEFQEYLQKLLQHPELSNSQLLADFLSPNGGETQFLD
KILPDVNLGKIIKSVPGKLMKEKGQHLESFIMNFINSCESPKPKPSRPELTILSPTSENN
KKLFNDLFKNNANRAENTERKQNQNYFMEMMTVEGVYDYLMYVGRVVFRIPDWFHHFLMG
IRILLKNTLETYTDYYLQCKLEQLFQEHRLVSLITLLRDAVFCENTEPRSLQDKQKRAKQ
TLEEMMNYIPDRIGKCIGDKANEGISLLFNGLQQPVLNKQLTYVLLDIVIQELFPELNKV
QKDTVSVSSWM
Download sequence
Identical sequences G3WRX2
ENSSHAP00000018177 ENSSHAP00000018177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]