SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000018221 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000018221
Domain Number 1 Region: 367-520
Classification Level Classification E-value
Superfamily PH domain-like 8.73e-55
Family Phosphotyrosine-binding domain (PTB) 0.000000358
Further Details:      
 
Domain Number 2 Region: 534-657
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-18
Family PDZ domain 0.0000654
Further Details:      
 
Domain Number 3 Region: 649-731
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000263
Family PDZ domain 0.0000329
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000018221   Gene: ENSSHAG00000015470   Transcript: ENSSHAT00000018371
Sequence length 740
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834482.1:1805246:1940819:-1 gene:ENSSHAG00000015470 transcript:ENSSHAT00000018371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANRKHQSTTSNMLDHRVRSCPTSSHNKESKGEETDLSLEEYAAKDVELATIRQGSPTPV
EHECNDNSGDGDSSSDYVNNTSEEEDYDEGLPEEEEGITYYIRYCPEDDSYLEGMDCNGE
EYIPHDEHNVETDECQEAVEEWTESKIQHHDGNDVEDRQEYPESHVQILEDEVSSLEIQD
QEESIQYCPSEESYQDYYPAEANGNSGGTSPYHIRKEDADLEEQEEDIDQIVAEIKMSMS
MSSINSTGEMSPEHVGMENVPNDYKETCSQEEVDHCASRHEGRPKSLNLPPTSKHAADAQ
RGFKTKARTPEERQKWPQEQVCNSLEQPRKQQRSDLNGPVDNNNMQETKKVASFPSFVAV
PGPCEPEDLIDGIIFAANYLGSTQLLSERNPSKNIRMMQAQEAVSRVKSSEGDSQTLTEV
DLFISTQRIKVLNADTQETMMDHALRTISYIADIGNIVVLMARRRMPRSASQDCIETTPG
AQEGKKQYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRANGINPEDLSQKEYSDIINT
QEMYNDDLIHFSNSENCKELHIEKQKGEILGVVIVESGWGSILPTVILANMMNGGPAARS
GKLSIGDQIMSINGTSLVGLPLATCQGIIKGLKNQIQVKLNIVSCPPVTTVLIKRPDLKY
QLGFSVQNGIICSLMRGGIAERGGVRVGHRIIEINGQSVVATAHEKIVQALSNSVGEIHM
KTMPAAMFRLLTGQETPLYI
Download sequence
Identical sequences G3WS16
ENSSHAP00000018221 XP_003755642.1.9362 XP_012398304.1.9362 ENSSHAP00000018221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]