SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000018257 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000018257
Domain Number 1 Region: 6-165
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 3.09e-43
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.00014
Further Details:      
 
Domain Number 2 Region: 165-296
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 2.38e-39
Family Hydroxyisobutyrate and 6-phosphogluconate dehydrogenase domain 0.0000277
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000018257   Gene: ENSSHAG00000015501   Transcript: ENSSHAT00000018407
Sequence length 300
Comment pep:known_by_projection scaffold:DEVIL7.0:GL861706.1:1817384:1953316:1 gene:ENSSHAG00000015501 transcript:ENSSHAT00000018407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASKTPVGFIGLGNMGNPMAKNLIKHGYPLVIYDVFPEACKDFKDSEQVVASPADVAERA
DRIITMLPTSHNALEVYTGPKGILKRVKKGSLLIDSSTIDPAVSKELAKEVEKMGAVFMD
SPVSGGVGAARAGNLTFMVGGLEREFAAARELLECMGSNVVYCGGVGTGQAAKICNNMLL
AISMIGTAEAMNLGIRLGLDPKLLAKILNMSSGRCWSSDTYNPVPGVMDGVPSANNYQGG
FGTVLMAKDLGLAQDSATSTKSPILLGGMSHQIYRMMCAKGYARKDFSSVFQFLREEENL
Download sequence
Identical sequences G3WS52
ENSSHAP00000018257 ENSSHAP00000018257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]