SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000018320 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000018320
Domain Number 1 Region: 2663-2951
Classification Level Classification E-value
Superfamily BEACH domain 9.94e-126
Family BEACH domain 0.0000000169
Further Details:      
 
Domain Number 2 Region: 3022-3221,3384-3416
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.5e-31
Family WD40-repeat 0.00099
Further Details:      
 
Domain Number 3 Region: 2509-2631
Classification Level Classification E-value
Superfamily PH domain-like 5.35e-23
Family PreBEACH PH-like domain 0.017
Further Details:      
 
Domain Number 4 Region: 3423-3489
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.34e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0013
Further Details:      
 
Domain Number 5 Region: 471-515,580-658
Classification Level Classification E-value
Superfamily ARM repeat 0.0000201
Family Armadillo repeat 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000018320   Gene: ENSSHAG00000015550   Transcript: ENSSHAT00000018470
Sequence length 3501
Comment pep:known_by_projection scaffold:DEVIL7.0:GL864774.1:1834294:2131518:-1 gene:ENSSHAG00000015550 transcript:ENSSHAT00000018470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNMVKRIMGRPRQEECSPQDNALGLMHLRRLFTELCHPPRHMTQKEQEEKLYMMLPVFNR
VFGNAPPNTMTEKFSDLLQFTTQVSRLMVTEIRRRASNKSTVEAASRAIVQFLEINQSEE
ASRGWMLLTTINLLASSGQKTVDCMTTMSVPSTLVKCLYLFFDLPHVPEVVGGAQNELPL
AERRGLLQKVFVQILVKLCSFVSPAEELAQKDDLQLLFSAITSWCPPYNLPWRKSAGEVL
MTISRHGLSVNVVKYIHEKECLSTCVQNMQQSDDLSPLEIVEMFAGLSCFLKDSSDVSQT
LLDDFRIWQGYNFLCDLLLRLEQAKEAESKDALKDLVNLITSLTTYGVSELKPAGITTGA
PFLLPGFAVPQPAGKGHSVRNIQAFAVLQNAFLKAKTSYLPQIILDAITNIYIADNANYF
ILESQHTLSQFAEKISKLPEVQTKYFEMLEFVVFSLNYIPCKELISVSILLKSSSSYQCS
IIATRTLLKFTRHDYIFKDVFREVGLLEVMVNLLHKYAAFLKDPQTLNEQGDSKNNSSVE
DQKQLALLVMETLTILLQGSNTNAGIFREFGGARCAHNIVKYPQCRQHALMIIQQLVLSP
SGDDDMGTLLGLMHSAPPTELQLKTDILRALLSVLRESHRTRTVFRKVGGFVYITSLLVA
MERSLSCPPKNGWEKVNQNQVFELLHTVFCTLTAAMRYEPANSHFFKTEIQYEKLADAVR
FLGCFSDLRKISPLNVFPSNTQPFQRLLEDDLTSIDSVSPTLRHCSKLFIYLYKVATDSF
DSHAEQIPPCLTNESSLPSPWGTPAVSRKRHAYHSVSTSSGYPSKNVADVKQQPAASSLQ
TSDAVVIHPGAMLAMLDLLSSVGSTSQPEHEISDMLSLIYVLLCLFYKENNNNFFCSFAL
KKRPFLNCAVIISHSKTIYKPFIKPTFLKRTTSNCRSSFSRGNHLKLRSGLVRGTSQKGM
ERHSIYSVYKRCPSFLLSLPERQCQVISSERVDGACPPFKNHMFHQVRVVQCDVCSKSCD
LVRADRGVPVIHFNVPEYILFCYHPYSSGWLILIFIFIILNFLSDPGICLDIVILMNTIL
TSFSLTNILEKKFLKTSFPSSTSEKCLYANIEQIKINKLKFLKNLLHISPQVNTGKSFSV
CVFICQLIDSSSNYSLKINNKTQILSNSIERISVEESSKRSMWVWVCVERGGGVYICVYT
HVYIYKHKHRDRHTNVALTLKGPMITDKNHSFSRRRSGQSSESPKDLNVCEAFVLRPACV
RCSKQRLCYLGDWLEQMQPPSMVLGPQQGLQPRTSVGPRSSHEMSQVHVQPYTMTRSHFQ
LGITPHLKARFALCFNPLQKKKSIVEDLLTRAENILPIGHISNRVSPLCQTSHKIPAAGV
FYSGVRTFVPKPVATTLQYIGGAAAILGLVAMASDVEGLYAAVKALVCVVKSNPLASKEM
ERIKGYQLLAMLLKKKRSLLNSHILHLTFSLVGTVDSGHETSIIPNSTAFQDLLCDFEVW
LHAPYELHLSLFEHFIELLTESSEASKNAKLMREFQLIPKLLLTLRDMSLSQPTIVAISN
VLSYLLQGFPNSNDLLRFGQFIASTLPTFAVCEKFVVMEINNEEKLDTGTEEDFGGLVSA
NLILLRNRLLDILLKLVYSSKEKTSINIQACEDLVRTLGFDWLLMFTEEHLHSTTVTAAM
RILVVLLSNQSVLIKFKEGLSGGGWLEQTDSVLTNKIGTVLGFNVGRSAGGRSAIREINR
DACHFPGFPVLQSFLPKHTNVPALYFLLMALFLQQPVAELPENLQVSVPVISSRCNQGCQ
FDLDSIWTFIFGVPASSGTVVSSIHNVCTEAAFLLLGMLRSMLNSPWQSEEEGSWLREYP
VTLMQFFRYLYHNVPDLSSMWMSPEFLCALAATVFPFNIRPYSEMVTDLDDEVGSPAEEF
KAFTGDTGMNRSQSEYCNVGSKTYLTNHPAKKFVFDFMRVLIIDNLCLTPASKQTPLIDL
LLEASPERSTRTQQKEFQTYVLDSVMDHLLAADVLLGEDASLPITSGGSYQILVNNVFYF
TQRVVDKLWQGMFNKESKLLIDFIIQLIAQSKRRSQGLSLDAVYHCLNRTILYQFSRAHK
TVPQQVALLDSLRVLTVNRNLILGPGNHDQEFISCLAHCLINLHVGSHVDGFGLEAEARM
TTWHIMIPSDIDPDGSCSQDVSEGRQLLIKAVNRVWTELIHSKKQALEELFKVTLPVNDR
GLVDITAARPLIEEAGLKCWQNHLAHEKKCISRGEALVPSTQSKLSRVSSGFGLSKLTGS
RRNRKESGLNKHNLSTQEISQWMFTHIAVVRDLVDTQYKEYQERQQNALKYVTEEWCQIE
YELLRERGLWGPPIGSHLDKWMLEMTEGPCRMRKKMVRNDMFYNHYPYVPEIEQETNVLK
PARYRRAISYDSKEYYMRLASGNQAFVQDAIVESSEGESTQQEPEHGEDTIAKVKGLVKP
PLKRSRSAPDGGDEENQEQLQDQIAEGSSIEEEEKTDNATLLRLLEEGEKIQHMYRCARV
QGLDTSEGLLLFGKEHFYVIDGFTMTATREIRDIETLPPNMHEPIIPRGARQGPSQLRRS
CSIFAYEDIKEVHKRRYLLQPIAVEVFSGDGRNYLLAFQKGVRNKVYQRFLAVVPSLTDS
SESVSGQRPNTSVEQGSGLLSTLVGEKSVTQRWERGEISNFQYLMHLNTLAGRSYNDLMQ
YPVFPWVLADYDSQEVDLTNPKTFRNLAKPMGAQTDERLTQYKKRYRDWEDPNGETPAYH
YGTHYSSAMIVASYLVRMEPFTQIFLRLQGGHFDLADRMFHSVREAWYSASKHNMADVKE
LIPEFFYLPEFLLNSNNFDLGCKQNGTKLGNVILPPWAKGDPREFIRVHREALECDYVSA
HLHEWIDLIFGYKQQGPAAVEAVNVFHHLFYEGQVDIYNINDPLKETATIGFINNFGQIP
KQLFKKPHPPKRVRSRLNGDNSGVSVPPGSTSDKIFFHHLDNLRPSLAPVKELKEPVGQI
VCTDKGILAVEQNKVLIPPTWNKTFAWGYADLSCRLGTYESDKAVTVYECLSEWGQILCA
ICPSPKLVITGGTSTVVCVWEMGTSKEKAKTLTLKQALVGHTDTVTCSTASLAYHIIVSG
SRDRTCIIWDLNKLSFITQLRGHRAPVSALCINELTGDIVSCAGTYIHVWSINGNPVVSV
NTFTGRSQQIVCCCMSEMNEWDTQNVIVTGHSDGVVRFWRMEFLQVPETPAPEPVEDLEM
QEDCPEAQIGHEGQDEDSSDSEAEEQSIVQDPKETPSQPSSVSHRPRTASCRATAAWLAD
SGSDDSRRWSDQLSLDEKDGFIFVNYSEGQPRGHLQGPLNHPHPYPVDVRHYNNLKPGYR
WERQLVFRSKLTMHTAFDRKDNAHPAEITALGISKDHSRILVGDSRGRVFSWSVSDQPGR
SAADHWVKDEGGDSCSGCSVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKRLKISSPVRV
CQNCYYNLQHERCPEDGPKNC
Download sequence
Identical sequences G3WSB5
ENSSHAP00000018320 ENSSHAP00000018320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]