SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000018682 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000018682
Domain Number 1 Region: 413-506
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 4.44e-24
Family Tudor domain 0.0000053
Further Details:      
 
Domain Number 2 Region: 199-279
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.11e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000869
Further Details:      
 
Domain Number 3 Region: 127-198
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.72e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000018682   Gene: ENSSHAG00000015859   Transcript: ENSSHAT00000018836
Sequence length 646
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856997.1:1938458:1975266:-1 gene:ENSSHAG00000015859 transcript:ENSSHAT00000018836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAFLNPRQDAVPNLMKLPGSPWLIKSGPRGLSPHKTGSSGPRTHTPETQGNARRNFKPS
MLHIGHGSRMQVRTSEKMSTEWSSWTNLSTIQKIALGLGIPASLTVAYILYRRYRESREE
RLTFVGEDDIEVEMRVPQEAVKLIIGRQGANIKQLRKQTGARIDVDTEDVGEERVLLISG
FPVQVCKAKAAIHQILTENTPVYEQLSVPQRSVGRIIGRGGETIRAICKSSGAKITCDKE
SEGTLLLTRLIKISGTQKEVAAAKHLILEKVSEDEELRKRIAHSAESRVQRKQPISVKRE
EVAGPGGAGEPAFPKDMGTGKKLAPSLAATPSRGGGDTAGLRPERVEHSHEKKLSDNSHQ
EDMGAQASPEMPKFEIPSPDFSFHADEYLEVYVSASENPNHFWIQIIGSRSLQLDKLVNE
MTQYYENSQSPEDLTVHVGDIVAAPLPTDGPWYRARVLGTLENGNLDLYFVDFGDNGESP
LKDLRAIRSDFLSLPFQAIECSLARIVPSGEQWEEEALDEFDHLTHCAEWKPLVAKISSY
VQTGISTWPEIHLYDTSNGQNLDIGLELVRQGYAVELPQDVGEGDAAVPEMLQDILATET
DASLDSLLSEAKKSPGETPHTLSCLSLSEAASVSGDDGVLAEDDLL
Download sequence
Identical sequences G3WTC7
ENSSHAP00000018682 ENSSHAP00000018682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]