SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000018776 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000018776
Domain Number 1 Region: 338-1018,1048-1205
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.88e-194
Family Motor proteins 0.000000023
Further Details:      
 
Domain Number 2 Region: 177-274
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000000145
Family PDZ domain 0.0063
Further Details:      
 
Domain Number 3 Region: 1399-1514
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000314
Family Myosin rod fragments 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000018776   Gene: ENSSHAG00000015937   Transcript: ENSSHAT00000018931
Sequence length 2007
Comment pep:known_by_projection scaffold:DEVIL7.0:GL857001.1:1964262:2094407:-1 gene:ENSSHAG00000015937 transcript:ENSSHAT00000018931 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFNLMKKDRDGSRKEKKEKKEKKERMSAAELRSLEEMSLRRGFFNLNRSSKRESKTRLEI
SNPIPIKVASGSDLHLTDIDSDSNRGSVILDSGHLSTASSSDDLKGDEGGRPSVLQRAAK
FGSLAKQNSQMIVKRFSFSQRSRDGSASETSTPSEHSAAPSPQVEVRTLEGQLARQAGPG
ARELELQRRPTGDFGFSLRRTTVLDRAPEGQAYRRVVHFAEPGAGTKDLALGLVPGDRLV
EINGQNVENKSRDEIVEMIRQSGDHVRLKVQPIPELSELSHSWLRGSLGQQREPTDAKTE
EQIAAEEAWHETEKVWLVHQDGFSLASQLKSEELSLPEGKVRVKLDHDGTILDVDEDDVE
KANAPSCDRLEDLASLVYLNESSVLHTLRQRYGASLLHTYAGPSLLILSPRGAPAMYSEK
VMHMFKGCRREEMAPHIYTVAQTAYRAMLMNRQDQSIVLLGSSGSGKTASCQHLVQYLAT
IAGTSGNKVFSVEKWQALYTVLEAFGNSPTIMNGNATRFSQILSLDFDQAGQVSSASVQT
MLLEKLRVARRPSSEATFNVFYYLLACGDSTLRTELHFNHLAENNIFGIVPLSKPEEKQK
AAQQFSKLQAAMKVLGISPDEQKACWFILAAIYHLGAAGATKEAAEAGRKQFARHEWAQK
AAYLLGCSLEELSSAIFKHQPKGSLQRSTSFRQGPEENSSGDATGPKLSALECVEGMASG
LYSELFTLLVSLVNRALKSSQNSLCSMMIVDTPGFQNPELGGSARGASFEELCHNYTQDR
LQALFHERTFVQELERYPQENVELAFDDLEPAGVDSVAVVDQASHQALVRSLARPEESRG
LLWLLEEEAVVPGGTDEALVERLFSYYGPQEGDKKGQSPLLRSSKPHHFLLGHSHNTNWV
EYNVEGWRNYAKQNPAMQNAPRLLQDSQKKIISNLFAGRAGSAMVLSGSIAGLEGGSQLA
LRRATSMRKTFTTGVAAVKKKSLCIQIKLQVDALIDTIRKSKVHFVHCLLPVAEGWVGEP
RSASSRRVSASSELDLPSGEHCEADLLPLDIALLRSQIRGSRLLDALRMYRQGYPDHMVF
SEFRRRFDILAPHLTKKHGRNYIVVDEKRAVEELLESLDLEKSSCYMGLSRVFFRAGTLA
RLEEQRDEQTSKNLTLFQAACRGFLARQHFQKRKIQDLAIRCVQKNIKKNKGVKDWPWWR
LFTAVRPLVEVQLSEEQIRGKDEEIQQLRSKLEKVEKERNELRLNSDRLETRXGGGASAR
GRGRSAGGGGGVFLSTPCSPALKTQYAALKKQMEATGIEGMEARLIRATELNGEMDDDDA
GGEWRLKYERAVREVDFTKKRLQQEFEDKLEVEQQSKRQLERKLVDLQADSDESQRTHQQ
LKKKCQRLTAELQDTRLHLEGQQVRNHELEKKQRRFDSELSQAHEETQREKLQREKLHRE
KDALLAEVFSLKQQMEEKDMDIAGFTQKVVSLEAELQDISSQESKDEASLAKIKKQLRDL
EAKTKDQEEELDEQAGTIQMLEQAKLRLEMEMERARQTHSKEIEGRDEEVEEVRQSCQKK
LKQMEAQLEEEYEDKQKVLREKRELESKLTALSDQVNQRDLESEKRLRKDLKRTKALLAD
AQIMLDHLKNSAPSKREIAQLKNQLEESEFTCAAAVKARKAMEVEIEDLHLQIDDISKAK
TGLEEQVSRLQREKNEIQSRLEEDQEDLNELMKKHKAAVAQASRDLAQMNDLQIQLEEAN
KEKQELQEKMQALQSQVEFLEQSMVDKSLVSRQEAKIRELETRLEFEKTQVKRLENLAGR
LKENMEKLTEERDQRSAAEGREKEQNKRLQRQLRDTKEEMGELAKKEAEASRKKHELEMD
LESLEAANQSLQADLKLAFKRIGDLQAAIEDEMESDDNEDLINSLQDMVTKYQKRKNKLE
GDSDVDSELEDRVDGVKSWLSKNKGPSKAASDDGSLKSSSPSSYQKSLALDRSDDEHDPL
DHAGRSRYSHSYLSDSDTEAKLGDSSA
Download sequence
Identical sequences G3WTM1
ENSSHAP00000018776 ENSSHAP00000018776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]