SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000018820 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000018820
Domain Number 1 Region: 266-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000102
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 85-212
Classification Level Classification E-value
Superfamily SET domain 0.0000000000000213
Family Histone lysine methyltransferases 0.027
Further Details:      
 
Domain Number 3 Region: 245-274
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000956
Family Classic zinc finger, C2H2 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000018820   Gene: ENSSHAG00000015972   Transcript: ENSSHAT00000018975
Sequence length 356
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834652.1:1973121:1991041:1 gene:ENSSHAG00000015972 transcript:ENSSHAT00000018975 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMGSVLPAEALVLKTGLKPQGLSLAEVITSDILHSFLYGRWRNVLGEQLFEEKSHHANPK
TAFTAEVLAQSFSGAEVQKLSSLVLPSEVIIAQSSIPGEGLGIFSKTWIKAGTEMGPFTG
RVISPEHVDICKNNNLMWEVFNEDGTVRYFIDASQEDHRSWMTYIKCARNEQEQNLEVVQ
IGNNIFYKAIEMIPPDQELLVWYGNSHNTFLGIPGVPGLEEEQKKNKHEDFHPVDTATNT
AGRMRCVICHRGFNSRSNLRSHMRIHTLDKPFVCRFCNRRFSQSSTLRNHVRLHTGERPY
KCQVCQSAYSQLAGLRAHQKSARHRPPNASLQAHSPALPVPHPTSLAAHHIPTMVL
Download sequence
Identical sequences G3WTR5
ENSSHAP00000018820 ENSSHAP00000018820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]