SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000018829 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000018829
Domain Number 1 Region: 394-506
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.96e-41
Family Pyk2-associated protein beta ARF-GAP domain 0.00045
Further Details:      
 
Domain Number 2 Region: 125-190,334-379
Classification Level Classification E-value
Superfamily PH domain-like 1.98e-17
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Domain Number 3 Region: 518-609
Classification Level Classification E-value
Superfamily Ankyrin repeat 7e-17
Family Ankyrin repeat 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000018829   Gene: ENSSHAG00000015980   Transcript: ENSSHAT00000018984
Sequence length 639
Comment pep:novel scaffold:DEVIL7.0:GL857018.1:1976835:2289237:-1 gene:ENSSHAG00000015980 transcript:ENSSHAT00000018984 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPINGVAQKIVATRKKQQLSIGPCKSLPNSPSHSSVCSAQVSAVHISQTSNGGGSLSDYS
SSVPSTPSTSQKELRIDVPPTANTPTPVRKQSKRRSNLFTSRKGSDPDKEKKSLESRADS
IGSGRAIPIKQGMLLKRSGKSLNKEWKKKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLL
RTTVKVPGKRPPRATSACAPISSPKTNGLAKDMSSLHISPNSGNVTASASVSQMASGVSL
VSFNTRPDGMHQRSYSVSSADQWSEATVIANSGISSDTGLGDSVCSSPSISSTTSPKLDP
PPSPHANRKKHRRKKSTSNFKADGLSGTAEEQEENFEFIIVSLTGQTWHFEAATYEERDA
WVQAIESQILASLQSCESSKNKSRLTSQNEAMALQSIRNIRGNSQCVDCEAQNPNWASLN
LGALMCIECSGIHRNLGTHLSRVRSLDLDDWPIELIKVMSSIGNELANSVWEESCQGHMK
PSLDSTREEKERWIRAKYEQKLFLAPLPCMELSLGQHLLRATADEDLRTVILLLAHGSRE
EVNETCGEGDGRTALHLACRKGNVVLVQLLIWYGVDVMARDAHGNTALAYARQAPSQECI
DILLQYGCPDERFVLMATPNLSRKNNSRNNSSGRMPTIL
Download sequence
Identical sequences G3WTS4
ENSSHAP00000018829 ENSSHAP00000018829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]