SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000018864 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000018864
Domain Number 1 Region: 24-98
Classification Level Classification E-value
Superfamily PDZ domain-like 5.99e-17
Family PDZ domain 0.00013
Further Details:      
 
Domain Number 2 Region: 510-545
Classification Level Classification E-value
Superfamily WW domain 0.00000000000148
Family WW domain 0.0018
Further Details:      
 
Domain Number 3 Region: 220-315
Classification Level Classification E-value
Superfamily EF-hand 0.00000486
Family Calmodulin-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000018864   Gene: ENSSHAG00000016013   Transcript: ENSSHAT00000019020
Sequence length 569
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856816.1:1988172:2183264:-1 gene:ENSSHAG00000016013 transcript:ENSSHAT00000019020 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMTGMNGNNSETTAFNQVAMDPAFQMITVTKAIGLGLNIVGGINRNEGPLVYIQEIIAGG
DCHKDGRLKPGDQLVYINKESLIGVSFEEAKSIITRAKLRSESAWEIGFIRQKLSSNQQE
TTQRSSLLSSTEGCETQVSTSFNVLSHHENFDQKMSSTPITVDTTLMSLKKNQIKTGFKK
REPSPITSPNNSPTDVSNPNINPNWPNDTGLQGENISLDPSIRLKIEKLEMALNYLGIQP
TEEEHKALRQQVQIDSKGTVSFGDFVQVSRELFRLQLNEVTIGQKSTMLSAREISHLLES
QLLPHDSSEMDEVEKLKHERNDALREVSKLKDKLLESENQRKQLTEELQNVKQEAKAVVE
ETRALRSRLHLAEAAQRQAHGMEMDYEEVIRLLEAEIKELKAQLADHTGQSKESFQDLRK
RITVLDCQLRKSETARKTFELTTEKLLNFVETIQEVLSDHSSSLSNFSDRRSILGSQTLF
PQLGRNGRNVTANLVQESRELAKSVRALLDVDRLPYGWEEAYTADGIKYFINHVTQTTSW
IHPVTSALNLSCLEENEEDCPRDRPNQKS
Download sequence
Identical sequences G3WTV9
ENSSHAP00000018864 ENSSHAP00000018864 XP_003768022.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]