SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000018892 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000018892
Domain Number 1 Region: 56-146
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.5e-17
Family PWWP domain 0.0000282
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000018892   Gene: ENSSHAG00000016036   Transcript: ENSSHAT00000019048
Sequence length 263
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856822.1:2000709:2005341:-1 gene:ENSSHAG00000016036 transcript:ENSSHAT00000019048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPHGGRFVSILIVSHLLITTFQTFFVLCRGTRHTWVVSTAPNLEIDEMPEAAVKSTANK
YQVFFFGTHETAFLGPKDLFPYEESKEKFGKPNKRKGFSEGLWEIENNPTVKASGYQPSQ
KKGCPEDAEPDREVSEGDGEKKGNTDGSSDEEGKLVIDEPSKEKNEKGALKRRAGDSLED
SPKRLKETQDPEGEGDEKEELALEGERALPTEGEKNSAPSEPGPGRGLVEEEEEEEEDDE
EEEEEETAKEEGPTQGVRDHKSL
Download sequence
Identical sequences G3WTY7
ENSSHAP00000018892 ENSSHAP00000018892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]