SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000019049 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000019049
Domain Number 1 Region: 63-574
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 1.77e-192
Family Myeloperoxidase-like 0.0000000000000197
Further Details:      
 
Domain Number 2 Region: 23-60
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000265
Family EGF-type module 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000019049   Gene: ENSSHAG00000016171   Transcript: ENSSHAT00000019205
Sequence length 609
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856758.1:2055287:2061406:-1 gene:ENSSHAG00000016171 transcript:ENSSHAT00000019205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMKRIAFLFIFSTAALALSQAANPCCSNPCQNRGICMTTGIDRYQCDCTRTGFYGENCTT
PEFLTRIKLMLKPTPDTVHYILTHFKSVWNIVNNIPFLRDFVMRYVLTSRSNLIESPPTY
NVHYGYKSWEAFSNLSYYTRALPPVRDDCPTPMGVKGKKQLPESKEVVEKCLLRRKFIPD
PQGTNMMFAFFAQHFTHQFFKTDHHRGPAFTKALGHGVDLNHIYGENLERQYKLRLFKDG
KMKYQVIDGEVYPPLVKDTQAEMIYPPHVPEHLKFAVGQEVFGLVPGLMMYATIWLREHN
RVCDILKQEHPEWDDEQLFQTSRLILIEIGETIKIVIEDYVQHLSGYYFKLKFDPELLFS
QSFQYQNRIAAEFNTLYHWHPLLPDTFQIEDKEYSYQQFLYNNSVLVEHGISHMVESFSR
QIAGRVAGGKNVPLAVKKVSIASIDQSRQMKYQSLNEYRKRFMLKPFSSFEELTGEKEMA
AELEALYGDIDAMELYPALLVEKPRPGAIFGETMVELGAPFSLKGLMGNPICSPDYWKPS
TFGGDVGFEIINTASIQSLICNNVKGCPFTAFSVQDSQLKTATINASSSNSGLDDINPTV
LLKERSTEL
Download sequence
Identical sequences G3WUE4
ENSSHAP00000019049 ENSSHAP00000019049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]