SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000019108 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000019108
Domain Number 1 Region: 17-96
Classification Level Classification E-value
Superfamily HR1 repeat 1.41e-18
Family HR1 repeat 0.0027
Further Details:      
 
Domain Number 2 Region: 501-590
Classification Level Classification E-value
Superfamily PDZ domain-like 2.16e-16
Family PDZ domain 0.0000406
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000019108   Gene: ENSSHAG00000016222   Transcript: ENSSHAT00000019264
Sequence length 684
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834643.1:2077253:2144330:1 gene:ENSSHAG00000016222 transcript:ENSSHAT00000019264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDTLPPPAGRPLEEGECYFRKGCNPLAQTGRSKLQNQRAALNQQIMKTVRMRTGAENLL
RATTNNKVRDQVLLELSYVNSDLQILKEELEGLNISVEVYQNTEETFTIPLIPLGLKETK
EVDLSVLLKDFILEHYSEDSSLYEDEIADLMDLRQACRTPSRDEAGIELLMTYFIQLGFV
ESRFFPPTRHMGILFTWYDSLTGVPVSQQNLLLEKASILFNIGAVYTQIGTRSNRQTQSG
LEHAVDAFQRAAGVLNYLKETFTHTPSYDMSPAMLNVLVKMMLAQAQEIIFEKISLPGIR
NEFFTLVKMAQEAAKVGEVYHQLHSAMSQEPVKENIPYSWATLVKVKSDHYRALAHYFAA
TILIDHQLNPGDDEDQQEKCLSQLYDHMPEGLTPLATLKNKNERKQLGKSHLRKAIADHE
ESVRAANLCKKLRNIEILQEILSVAHKRSHLKYSQYEQDDDFLNLIDAPDIISKTEQEAE
MMAPQFSKVAVTDFFQKLGPLSVFSASKRWTAPRNIHFTIEDDDLGFTLRGGSPVQVHFL
DPYCSAALAGAKEGDYIVSIQDIDCKWLTVSEVIQKLKSLGKEVIEMKVISLLDSTSSMH
NKCATYSVGMQKTYSMICLAIEDDKIDKTKKISKKLSFLSWGTNKNRQKSASTLCLPSVG
VVRPQIKKKLPSPFGLLSTESSLY
Download sequence
Identical sequences G3WUK3
XP_012409220.1.9362 ENSSHAP00000019108 ENSSHAP00000019108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]