SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000019124 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000019124
Domain Number 1 Region: 390-520
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000235
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 2 Region: 325-365
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000931
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 3 Region: 285-324
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000126
Family EGF-type module 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000019124   Gene: ENSSHAG00000016236   Transcript: ENSSHAT00000019280
Sequence length 691
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834508.1:2084005:2092100:1 gene:ENSSHAG00000016236 transcript:ENSSHAT00000019280 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAASGKLSHWALLLLAAFWQQQRAAGSGVFQLQLREFANEQGVLASGRPCEPHCRTFFR
ICLKHFQAVLSPGPCTFGNVSTPVLGTNSFAVGEESRGGGRNPLQLPFNFTWPGTFSLII
EAWHAPGDNLPPEALPTDTLISTMAIQRPLTVGKNWSSDEQSGPLTRLRYSYRVICSDNY
YGDSCSRLCRSRDDHFGHYVCQADGSLSCLPGWTGEYCDQPICLSGCTEQNGYCNKPGEC
LCRPGWQGRLCDKCIPHNGCRHGTCTIPWQCTCDEGWGGLFCDQDLNYCTHHSPCRNGGT
CSNSGQRGYTCTCRPGFTGVDCEDEIRECDSNPCRNGGSCKDQEDGYHCLCPPSYYGPHC
EHSILSCADSPCFNGGSCREQEHGASYACECPPSFTGSNCEKKVDRCTSNPCANGAQCLE
WGPTRACRCRPGFTGPHCEININDCARNPCAHGGTCHDFVNAYVCTCPPGFSGRNCELRT
VGNACVSGPCLNGGTCYNGLSSDSFVCNCPYDFMGSRCEFLVHSPAQVVQQSSSFPWVAV
SLGVGLVAILVLLGMVAVAVRQLRLRRPEASGREAMNNLSDFQKDNLIPATQLKNTNQKK
ELEVDCDVDKSNCSKQQKHTDYNLAPGPLGRGVTLGKYPPNDKSLGEKAPLRLHSEKPEC
RISAICSPRDSMYQSVCLISEERNECVIATE
Download sequence
Identical sequences G3WUL9
ENSSHAP00000019124 ENSSHAP00000019124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]