SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000019233 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000019233
Domain Number 1 Region: 311-463
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.95e-52
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000404
Further Details:      
 
Domain Number 2 Region: 151-309
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.01e-48
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000557
Further Details:      
 
Domain Number 3 Region: 26-63
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000011
Family EGF-type module 0.011
Further Details:      
 
Domain Number 4 Region: 67-111
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000002
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000019233   Gene: ENSSHAG00000016335   Transcript: ENSSHAT00000019389
Sequence length 471
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834472.1:2124257:2146803:1 gene:ENSSHAG00000016335 transcript:ENSSHAT00000019389 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQGPRLLQTLGRLLLSLSVVLAASGEDCDPSLCLNGGTCLNGSESSTFYCLCPDGFTGQN
CQETEQGPCIPNPCQNNGLCRVVTESRRGDVFAQYVCDCPEGYEGPHCQRASESSDLLVE
FLYLTRVPNQEEGYICKCPSPFMGKSCQSRCNMPLGMEGGAIADFQISASSVHYSFLGMQ
RWGPELARLNAKGIVNAWTASNYDKNPWIQVNLLRKMRITGIMTQGASRTGSAEYLRTFK
VAYSNDGQVFEFIQDPNLHRDQVFVGNIDNNGQKTNVFDPPLVAQYVRIAPVVCRRACTL
RFELFGCEVEGCSEPLGMKSEIIPDSKITASSTFKTFGLDAFSWHPYYARLDKQGKFNAW
TAQSKEDTEWLQIDLGTPKKVTGVITQGARDFGNIQYVSAYKVAYSNDGKSWTVYRDSRT
NSNKVFLGNSDNYSHQKNMFKTPFYSRFVRILPVAWHGRITLRRVLHRGGM
Download sequence
Identical sequences G3WUX8
ENSSHAP00000019233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]