SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000019236 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000019236
Domain Number 1 Region: 195-361,419-572
Classification Level Classification E-value
Superfamily L domain-like 2.36e-47
Family Ngr ectodomain-like 0.0000397
Further Details:      
 
Domain Number 2 Region: 841-1031
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.01e-39
Family Laminin G-like module 0.0032
Further Details:      
 
Domain Number 3 Region: 2-175
Classification Level Classification E-value
Superfamily L domain-like 2.11e-38
Family Ngr ectodomain-like 0.00088
Further Details:      
 
Domain Number 4 Region: 696-739
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000283
Family EGF-type module 0.012
Further Details:      
 
Domain Number 5 Region: 727-855
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000879
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 6 Region: 613-653
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000266
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 7 Region: 655-699
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000327
Family EGF-type module 0.013
Further Details:      
 
Domain Number 8 Region: 1112-1143
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000198
Family EGF-type module 0.018
Further Details:      
 
Domain Number 9 Region: 1069-1105
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000467
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000019236   Gene: ENSSHAG00000016337   Transcript: ENSSHAT00000019392
Sequence length 1222
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834618.1:2125111:2272250:-1 gene:ENSSHAG00000016337 transcript:ENSSHAT00000019392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLEQNSIKSIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIAK
GLFDGLVSLQLLLLNANKINCLRVNTFQDLHNLHLLSLYDNKLQTISKGLFAPLQSIQTL
HLAQNPFVCDCHLKWLADYLQDNPIETSGARCSSPRRLANKRISQIKSKKFRCSEKDLRI
NPGSEDYRNKFSGDCFMDLVCPEKCRCEGTIVDCSNQKLVRIPNHIPEYVTDLRLNDNEI
SVLEATGIFKKLPNLRKINLSNNKIKEVREGVFDGAANVQELMLTGNQLELVHGRMFRGL
TSLKTMMLRSNLISCVNNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNP
FNCNCHLAWLGKWLRKRRIVSGNPRCQKPFFLKEIPIQDVAIQDFTCDGTECNDESSCQV
APRCPEQCTCMETVVRCSNKGLRVLPKGIPKDVTELYLEGNHLTTVPKELSNLRHLTLID
LSNNSISVLANYTFSNMTQLSTLILSYNQLRCIPVHAFNGLRSLRVLTLHGNDISSVPEG
SFNDLTALSHLALGTNPLHCDCSLRWLSEWVKAGYKEPGIARCSSPEHMADRLLLTTPTH
RFQCKGAVDISIAAKCNPCLSSPCKNNGTCSTDPTEVYRCSCPYGYKGRDCNMPINTCIQ
NPCQHGGICHLSETNPNGFSCSCPLGFEGERCEINPDDCEDNDCENNSTCLDGINNYVCV
CPPNYTGELCDEVIDHCVPEMSLCQHGAKCVSLDKGFRCECPPGFSGKLCETDDDDCVAH
KCRHGAQCVDAINGYTCICPQGFSGLFCEHPPPMVLLQTSPCDQYECQNGAQCIVVQQEP
TCRCLAGFAGQRCEKLITVNFVGKDSYVELASAKIRPQANISLQVATDKDNGILLYKGDN
DPLALELYQGHVRLVYDSLSSPPTTVYSVETVNDGQFHSVELVVLNQTLNLVVDKGTPKS
LGKLHKQPTVGTNTPLYIGGIPTSTGLSALRQGTDRTLGGFHGCIHDVRINNELQDFKAL
PQQSPGVFPGCKSCTICKHGMCRSVEKGSVVCECHPGWTGPLCDQEAGDSCLGHRCVHGK
CVASGSTYTCRCAEGYVGASCDQRNDSVSPCRDFKCFHGQCRISERGQPYCECEPSFSGE
HCEREHPCQGEVVREVIRRQQGYASCATASKVPLMECRGSCGSQCCVPTRSKRRKYVFQC
TDGSSFVEELERHVECGCQKCS
Download sequence
Identical sequences G3WUY1
ENSSHAP00000019236 ENSSHAP00000019236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]