SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000019335 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000019335
Domain Number 1 Region: 27-183
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.95e-32
Family Laminin G-like module 0.0034
Further Details:      
 
Domain Number 2 Region: 203-238
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000376
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000019335   Gene: ENSSHAG00000016422   Transcript: ENSSHAT00000019491
Sequence length 239
Comment pep:novel scaffold:DEVIL7.0:GL834539.1:2163125:2163841:-1 gene:ENSSHAG00000016422 transcript:ENSSHAT00000019491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GAAMGFTLHSIYFTLKFSVLLGSLLGLCLGLEFMGLPNQWARYLRWDASTRSDLSFQFKT
NVSAGLLLYLDDGGVCDFLCLSLVDGRVQLRFSMDCAETAVLSDKQVNDSSWHFLMVSRD
RMRTVLVLDGEARPGEVQPQRPHMDVVSDLFVGGVPADIRPSALTLEGVQTMPAFKGFIL
DLKYGNSEPRLLGTQGAQVEAEGPCAESPCENGGVCFLLDGHPTCDCSATGYGGKLCSE
Download sequence
Identical sequences G3WV80
ENSSHAP00000019335 ENSSHAP00000019335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]