SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000019388 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000019388
Domain Number 1 Region: 83-207
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.07e-46
Family Regulator of G-protein signaling, RGS 0.000000799
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000019388   Gene: ENSSHAG00000016466   Transcript: ENSSHAT00000019545
Sequence length 216
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834659.1:2183538:2207773:1 gene:ENSSHAG00000016466 transcript:ENSSHAT00000019545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTADEAGKQHTGPEEADRPPSMSRNDPAPLAPSRPNACCFCWCCCCSCSWNEDRQRAWK
TSRETRLETIPNCETCTKPSPEEVQSWAKSFDKLMKNPAGRNVFREFLRTEYSEENMLFW
LACEELKGEGNKQAIDEKARLIYEDYISILSPKEVSLDSRVREVINKKMQEPSSHTFDDA
QLQIYTLMHRDSYPRFLNSAFYKALLLNTSRSSSES
Download sequence
Identical sequences G3WVD3
ENSSHAP00000019388 XP_012409550.1.9362 XP_012409551.1.9362 ENSSHAP00000019388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]