SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000019461 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000019461
Domain Number 1 Region: 436-693
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.62e-71
Family Eukaryotic proteases 0.0000000781
Further Details:      
 
Domain Number 2 Region: 28-142
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.64e-31
Family Spermadhesin, CUB domain 0.00000235
Further Details:      
 
Domain Number 3 Region: 185-299
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-24
Family Spermadhesin, CUB domain 0.0000856
Further Details:      
 
Domain Number 4 Region: 370-441
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000222
Family Complement control module/SCR domain 0.0000755
Further Details:      
 
Domain Number 5 Region: 316-373
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000806
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 6 Region: 138-182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000495
Family EGF-type module 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000019461   Gene: ENSSHAG00000016527   Transcript: ENSSHAT00000019618
Sequence length 694
Comment pep:known_by_projection scaffold:DEVIL7.0:GL861612.1:2210923:2225499:1 gene:ENSSHAG00000016527 transcript:ENSSHAT00000019618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRLNPLLPVLWSSSPSLYSSVLTWAEETSMYGEILSPNYPQAYPNNAHKTWKITVPDGYG
IHLYFTHLDMELSANCEYDFVKIMSGDLVEGVLCGQKSSKNPSSPIVKEYHVPYNSLDVI
FESDFSNEERFTGFAAYYVAIDINECTDFNDSPCSHFCNNFIGGYFCSCPPEYFLYDDMK
NCGVNCSGNMFTDLTGEITSPNYPSLYPENSRCDYRVFLEKGFQVVVTIKREDFDVEAGD
SEGDCPDSLLVRAGGQQFGPYCGNGFPGQQIIETKDNVLDIIFQTDETGQKKGWKLRYYG
DPMPCPKEFTANSIQDPVKAKYVYQDTVKITCLEGFEVVQGRVSSTSFYSTCQSNGQWSN
SNLKCKPVDCGIPEPIKNGKTDNTKYTLFGAVTQYTCNEPYYYMKTEGTGEYRCAANGTW
VNKVLGAELPQCVAVCGVPSQPFSENQRIFGGKRADIGSFPWQVFFQYPRAGGALIDEHW
VLTAAHVLEGNANPIMYMGTTKVDRAALDEAQLLVADGVFIHPNWSPVANLEARKNFDND
IALVRLKDPVKMGPNVSPICLPGTSSEYDLKYGTLGMISGWGQANRRLNVVELRGARLPV
APLVKCQSVKSDDATVDISTFSFTSNMICAGGEKGSDSCKGDSGGAFAVQVPNQENNKLY
VAGLVSWGPKCGTYGIYTKVKNYISWIEKTMQEN
Download sequence
Identical sequences G3WVK6
ENSSHAP00000019461 ENSSHAP00000019461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]