SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000019521 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000019521
Domain Number 1 Region: 443-699
Classification Level Classification E-value
Superfamily YWTD domain 6.15e-61
Family YWTD domain 0.000000846
Further Details:      
 
Domain Number 2 Region: 1357-1614
Classification Level Classification E-value
Superfamily YWTD domain 4.58e-56
Family YWTD domain 0.0000033
Further Details:      
 
Domain Number 3 Region: 745-1000
Classification Level Classification E-value
Superfamily YWTD domain 4.45e-55
Family YWTD domain 0.00000141
Further Details:      
 
Domain Number 4 Region: 1052-1306
Classification Level Classification E-value
Superfamily YWTD domain 7.06e-49
Family YWTD domain 0.00000339
Further Details:      
 
Domain Number 5 Region: 355-435,691-740
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000188
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 6 Region: 266-306
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000602
Family LDL receptor-like module 0.00065
Further Details:      
 
Domain Number 7 Region: 149-186
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000103
Family LDL receptor-like module 0.00061
Further Details:      
 
Domain Number 8 Region: 311-347
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000113
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 9 Region: 230-268
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000183
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 10 Region: 68-106
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000484
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 11 Region: 1311-1356
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000723
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 12 Region: 189-227
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000812
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 13 Region: 104-140
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000196
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 14 Region: 1007-1055
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000631
Family EGF-type module 0.015
Further Details:      
 
Domain Number 15 Region: 26-68
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000017
Family LDL receptor-like module 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000019521   Gene: ENSSHAG00000016580   Transcript: ENSSHAT00000019678
Sequence length 1911
Comment pep:known_by_projection scaffold:DEVIL7.0:GL864893.1:2236832:2282429:-1 gene:ENSSHAG00000016580 transcript:ENSSHAT00000019678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRSWKGAYRLSLWLTAPGLSSSPECACGRSHFTCAVSALGECTCIPAQWQCDGDNDCGDH
SDEDGCMLPTCSPLDFHCDNGKCIRRSWVCDGDNDCEDDSDEQDCPPRECEEDEFPCQNG
YCIRSLWHCDGDNDCGDNSDSSQPQDMRKCSEKEFRCSDGSCIAEHWYCDGDTDCKDGSD
EESCPSAVPAPPCNLEEFQCAYGRCILDIYHCDGDDDCGDWSDESDCSSHQPCRSGEFMC
DSGLCINAGWRCDGDADCDDQSDERNCTTSMCMAEQFRCTSGRCVRLSWRCDGEDDCSDN
SDEENCENTGSPQCASDQFLCGNGRCIGQRKLCNGVNDCADNSDESPQQNCRPWTGQENC
NVNNGGCAQKCQMLRGAVQCTCHTGYRLMEDGRSCHDVNECAEEGYCSQGCTNSDGAFQC
WCEAGYELRPDRRSCKALGPEPVLLFANRIDIRQVLPHRSEYTLLLNNLENAIALDFHHR
RELVFWSDVTLDRILRANLNGSNVEEVVSTGLESPGGLAIDWLHDKLYWTDSGTSRIEVA
NLDGAHRKVLLWQNLEKPRAIALHPMEGTIYWTDWGNTPRIEASSMDGSGRRIIADTHLF
WPNGLTIDYAGHRMYWVDAKHHVIERADLDGSNRKAVISQGLPHPFAITVFEDSLYWTDW
HTKSINSANKFTGKNQEIIRNKLHFPMDIHTLHPQRQPAGRNRCGNNNGGCTHLCLPSGQ
NYTCACPTGFRKTSSHTCAQSLDKFLLFARRMDIRRISFDTEDLSDDVIPLADVRSAVAL
DWDSRDDYVYWTDVSTDTISRAKWDGTGQEVVVDTSLESPAGLAIDWVTNKLYWTDAGTD
RIEVANTDGTMRTVLIWENLDRPRDIVVEPRGGFMYWTDWGASPKIERAGMDASGRQVII
SSNLTWPNGLAIDYGSQRLYWADAGMKTIEFAGLDGSKRKVLIGTQLPHPFGLTLYGERI
YWTDWQTKSIQSADRLTGLDRETLQENLENLMDIHVFHRLRPPVHTPCAVDNGGCSHLCL
RSPHPKGYSCTCPTGINLLPDGKTCSSGMRSFLIFARRIDIRMVSLDIPYFADVVVPVNV
TMKNTIAIGVDPQEGKVYWSDSTLRRISRANLDGSQHEDIITTGLQTTDGLAVDAIGRKV
YWTDTGTNRIEVGNLDGSMRKVLVWQNLDSPRAIVLYHEMGSMYWTDWGENAKLERAGMD
GSDRTVLISNNLGWPNGLTVDKAGSQLLWADAHTERIEATDLNGANRRTLVSPVQHPYGL
TLLDSYIYWTDWQTRSIHRADKGTGRNVILVRANLPGLMDIQAVDRQWPLGTNKCGPKNG
GCSHLCLPTPSGFSCACPTGIQLKGDGKTCDPSPETYLLFSSRGSIRRISLDTNDHTDVH
VPVPELNNVISLDYDSVDGKVYYTDVFLDVIRRADLNGSNMETVIGRGLKTTDGLAVDWV
ARNLYWTDTGRNTIEASRLDGSCRKVLINNSLDEPRAIAAFPRKGYLFWTDWGHLAKIER
SNLDGSERKLLINTDLGWPNGLTLDYDTRRIYWVDAHLDRIESADLNGKLRQVLVSHVSH
PFALTQQDRWIYWTDWQTKSIQRVDKYSGRNKETVLANVEGLMDIIVVSPQRQTGTNACG
VNNGGCTHLCFARALDFVCACPDEPDGRPCSLVPGLVPSAPKSTSSSEKRSMAPNTPPTT
SRSSTSRTHTSAEEAEESCSEKDGRQGLCAHSNEAVPAIPGEGLHVSYVIGGLLSILLIL
LLFAALMLYRHKKFKFTDPGLGNLTYSNPSYRTSTQEVKIETIPKPAMYNQLCYKKETGP
EHTYTKEKIKIVEGICLLSGGGDDAEWDDLKQLRGSRGGLLLRDHVCMKTDTVSIQASSG
SLDDTETEQLLQEELSECSSVHTATATPERRGSLPDTGWKHERKLSTESRV
Download sequence
Identical sequences G3WVR6
ENSSHAP00000019521 ENSSHAP00000019521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]