SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000019522 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000019522
Domain Number 1 Region: 430-686
Classification Level Classification E-value
Superfamily YWTD domain 6.02e-61
Family YWTD domain 0.000000846
Further Details:      
 
Domain Number 2 Region: 1344-1601
Classification Level Classification E-value
Superfamily YWTD domain 4.58e-56
Family YWTD domain 0.0000033
Further Details:      
 
Domain Number 3 Region: 732-987
Classification Level Classification E-value
Superfamily YWTD domain 4.45e-55
Family YWTD domain 0.00000141
Further Details:      
 
Domain Number 4 Region: 1039-1293
Classification Level Classification E-value
Superfamily YWTD domain 6.93e-49
Family YWTD domain 0.00000339
Further Details:      
 
Domain Number 5 Region: 347-422,678-727
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.88e-17
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 6 Region: 253-293
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000563
Family LDL receptor-like module 0.00065
Further Details:      
 
Domain Number 7 Region: 298-334
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000114
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 8 Region: 217-255
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000183
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 9 Region: 132-172
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000209
Family LDL receptor-like module 0.00059
Further Details:      
 
Domain Number 10 Region: 55-94
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000038
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 11 Region: 1298-1343
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000994
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 12 Region: 93-131
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000511
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 13 Region: 176-214
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000746
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 14 Region: 994-1042
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000625
Family EGF-type module 0.015
Further Details:      
 
Domain Number 15 Region: 15-57
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000157
Family LDL receptor-like module 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000019522   Gene: ENSSHAG00000016580   Transcript: ENSSHAT00000019679
Sequence length 1898
Comment pep:known_by_projection scaffold:DEVIL7.0:GL864893.1:2236832:2281581:-1 gene:ENSSHAG00000016580 transcript:ENSSHAT00000019679 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSLSPGLSSSPECACGRSHFTCAVSALGECTCIPAQWQCDGDNDCGDHSDEDGCMLPTC
SPLDFHCDNGKCIRRSWVCDGDNDCEDDSDEQDCPPRECEEDEFPCQNGYCIRSLWHCDG
DNDCGDNSDEQCDMRKCSEKEFRCSDGSCIAEHWYCDGDTDCKDGSDEESCPSAVPAPPC
NLEEFQCAYGRCILDIYHCDGDDDCGDWSDESDCSSHQPCRSGEFMCDSGLCINAGWRCD
GDADCDDQSDERNCTTSMCMAEQFRCTSGRCVRLSWRCDGEDDCSDNSDEENCENTGSPQ
CASDQFLCGNGRCIGQRKLCNGVNDCADNSDESPQQNCRPWTGQENCNVNNGGCAQKCQM
LRGAVQCTCHTGYRLMEDGRSCHDVNECAEEGYCSQGCTNSDGAFQCWCEAGYELRPDRR
SCKALGPEPVLLFANRIDIRQVLPHRSEYTLLLNNLENAIALDFHHRRELVFWSDVTLDR
ILRANLNGSNVEEVVSTGLESPGGLAIDWLHDKLYWTDSGTSRIEVANLDGAHRKVLLWQ
NLEKPRAIALHPMEGTIYWTDWGNTPRIEASSMDGSGRRIIADTHLFWPNGLTIDYAGHR
MYWVDAKHHVIERADLDGSNRKAVISQGLPHPFAITVFEDSLYWTDWHTKSINSANKFTG
KNQEIIRNKLHFPMDIHTLHPQRQPAGRNRCGNNNGGCTHLCLPSGQNYTCACPTGFRKT
SSHTCAQSLDKFLLFARRMDIRRISFDTEDLSDDVIPLADVRSAVALDWDSRDDYVYWTD
VSTDTISRAKWDGTGQEVVVDTSLESPAGLAIDWVTNKLYWTDAGTDRIEVANTDGTMRT
VLIWENLDRPRDIVVEPRGGFMYWTDWGASPKIERAGMDASGRQVIISSNLTWPNGLAID
YGSQRLYWADAGMKTIEFAGLDGSKRKVLIGTQLPHPFGLTLYGERIYWTDWQTKSIQSA
DRLTGLDRETLQENLENLMDIHVFHRLRPPVHTPCAVDNGGCSHLCLRSPHPKGYSCTCP
TGINLLPDGKTCSSGMRSFLIFARRIDIRMVSLDIPYFADVVVPVNVTMKNTIAIGVDPQ
EGKVYWSDSTLRRISRANLDGSQHEDIITTGLQTTDGLAVDAIGRKVYWTDTGTNRIEVG
NLDGSMRKVLVWQNLDSPRAIVLYHEMGSMYWTDWGENAKLERAGMDGSDRTVLISNNLG
WPNGLTVDKAGSQLLWADAHTERIEATDLNGANRRTLVSPVQHPYGLTLLDSYIYWTDWQ
TRSIHRADKGTGRNVILVRANLPGLMDIQAVDRQWPLGTNKCGPKNGGCSHLCLPTPSGF
SCACPTGIQLKGDGKTCDPSPETYLLFSSRGSIRRISLDTNDHTDVHVPVPELNNVISLD
YDSVDGKVYYTDVFLDVIRRADLNGSNMETVIGRGLKTTDGLAVDWVARNLYWTDTGRNT
IEASRLDGSCRKVLINNSLDEPRAIAAFPRKGYLFWTDWGHLAKIERSNLDGSERKLLIN
TDLGWPNGLTLDYDTRRIYWVDAHLDRIESADLNGKLRQVLVSHVSHPFALTQQDRWIYW
TDWQTKSIQRVDKYSGRNKETVLANVEGLMDIIVVSPQRQTGTNACGVNNGGCTHLCFAR
ALDFVCACPDEPDGRPCSLVPGLVPSAPKSTSSSEKRSMAPNTPPTTSRSSTSRTHTSAE
EAEESCSEKDGRQGLCAHSNEAVPAIPGEGLHVSYVIGGLLSILLILLLFAALMLYRHKK
FKFTDPGLGNLTYSNPSYRTSTQEVKIETIPKPAMYNQLCYKKETGPEHTYTKEKIKIVE
GICLLSGGGDDAEWDDLKQLRGSRGGLLLRDHVCMKTDTVSIQASSGSLDDTETEQLLQE
ELSECSSVHTATATPERRGSLPDTGWKHERKLSTESRV
Download sequence
Identical sequences G3WVR7
ENSSHAP00000019522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]