SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000019530 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000019530
Domain Number 1 Region: 32-128
Classification Level Classification E-value
Superfamily Immunoglobulin 1.83e-16
Family I set domains 0.014
Further Details:      
 
Domain Number 2 Region: 174-227
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000788
Family EGF-type module 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000019530   Gene: ENSSHAG00000016586   Transcript: ENSSHAT00000019687
Sequence length 639
Comment pep:known_by_projection scaffold:DEVIL7.0:GL864734.1:2240100:2449987:-1 gene:ENSSHAG00000016586 transcript:ENSSHAT00000019687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEKKDGKARGRGKKKERGSGQKTAPPEGAAPPRLKEMENKNSTAGSRLVLRCETSSEYS
SLKFKWFKNGSELSRKNKPQNVKIQKKPGKSELRINKATIADSGEYMCKVISKLGNDSAY
ANITIVESNETVTSMPASTERASMPSEYPTRISMSTEGTNTSSSTSTSTAGTSHLVKCAE
KDKTFCVNGGECFIVKDPSNPSRYSCKCPNEFTGDRCQNYVMASFYKAEELYQKRVLTIT
GICIALLVVGIMCVVAYCKTKKQRKKLHDRLRQSLRSERNNMVNMANGPHHPNPPPENVQ
LVNQYVSKNIISSEHVIERETETSFSASHCTSPAHHSMAATQTPSHSWSNGHTESIVSES
HSVLVISSIENSRHTSPAGGPRGRLNGMGGPRDCNSFLRHARETPDSYRDSPHSERYVSA
MTTPARMSPVEFYMPSSPKSPPSEISPPISSLTVSMPSVAVSPLVEEERPLLLVTPPRLR
EKKYDHHPQQFNSFHHNPVHESNSLPPSPLRIVEDEEYETTQEYETTQEYEPAQEPTKKL
VNSRRAKRTKPDGHISNRLEMDSDTSSENSNSESETEDERIGENTPFLSIQTPMAAGLES
APAFRLADSRTNPTSRYSTQEEFQARLSSVIANQDPIAV
Download sequence
Identical sequences G3WVS5
ENSSHAP00000019530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]