SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000019582 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000019582
Domain Number 1 Region: 13-133
Classification Level Classification E-value
Superfamily PH domain-like 1.21e-27
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 
Domain Number 2 Region: 148-213
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 6.72e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000019582   Gene: ENSSHAG00000016627   Transcript: ENSSHAT00000019739
Sequence length 284
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834645.1:2258446:2259300:-1 gene:ENSSHAG00000016627 transcript:ENSSHAT00000019739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDHLVNTEINSQRIAAVENCFGASGQPLALPGRVLLGEGILTKECRKKAKPRIFFLFND
ILVYGSIVINKRKYSSQHIIPLEEVTLETLPNTWQAKNRWMIKTSKKSFVVSAASVSERE
EWIRHIEECVRRQLRATGRPPTTEHAAPWIPDKATDICMRCTQTKFSALTRRHHCRKCGF
VVCGDCSRERFLMPRLSSKPLRVCALCYRELAAEKRKEEGEAEEDGQRRPPRGLAHPPAT
TYGASSGEDESDKSDEDKDGGSAGSWPMGLEFYASGVKWSSFHS
Download sequence
Identical sequences G3WVX7
ENSSHAP00000019582 ENSSHAP00000019582 XP_012409228.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]