SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000019606 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000019606
Domain Number 1 Region: 442-696
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.83e-74
Family Eukaryotic proteases 0.000000116
Further Details:      
 
Domain Number 2 Region: 21-140
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-29
Family Spermadhesin, CUB domain 0.0000971
Further Details:      
 
Domain Number 3 Region: 193-304
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.71e-27
Family Spermadhesin, CUB domain 0.0000503
Further Details:      
 
Domain Number 4 Region: 309-380
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000306
Family Complement control module/SCR domain 0.000033
Further Details:      
 
Domain Number 5 Region: 377-450
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000459
Family Complement control module/SCR domain 0.00011
Further Details:      
 
Domain Number 6 Region: 161-192
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000304
Family EGF-type module 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000019606   Gene: ENSSHAG00000016644   Transcript: ENSSHAT00000019763
Sequence length 706
Comment pep:novel scaffold:DEVIL7.0:GL861612.1:2267772:2281830:-1 gene:ENSSHAG00000016644 transcript:ENSSHAT00000019763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLWCLLGFLLLCKMGSSKPLIHELYGEVTSPMYPKPYPNNYDYTREIVVPKGYTVKLVFW
QFDLEPSENCFYDYVKISADKKDLGRFCGQLGSKAGNPPAQKEFVSQGNRMWLTFHTDFS
NEENGTSIFYKGFLAYFQAVDMDECSIQSNDNEESSKSGIRCEHLCHNSIGSYFCSCRPG
YELQDDGHSCRAECSSELFTEESGYIASLEYPKAYPPDMRCNYSIRVDRGLTINLEFLEP
FEIDDHQQVHCPYDQLQVYASGKPLGEYCGMRSPGIINTSSNAVDVLFFTDESGDSRGWK
IHYATEIIKCPQPKTLDEFTVISNPQQQYQFRDYLIVTCKTGYQLTEGKQKLKSFTSFCQ
DDGTWHRAMPRCKIVNCGVPQDLPNGNFSYITKKGENTYQSEILYTCREPYYQMANKEKS
VTYTCTAQGIWKDRYGNKIPRCLPVCGKPVNPVIENQRIIAGKNARLGNFPWQVFTNIYG
RGGGALLGDRWILTAAHTIKPKDNPSVQNTSIHVFLGHTNLDEIMKMGAHPVRDVFIHPG
YDQSDMNNFDNDIALLELENSIPLGPYLLPICLPDNETLYEKGFMGYVSGFGIEDQKIHD
DLKFVSLPVVSRENCQNWLNSKRSSQVFSNNMFCAGDKTAKKDACQGDSGGVFAVKDETG
NRWVATGIVSWGIGCGRGYGFYTKVLQYVDWIKKTMRKKRTDPRKS
Download sequence
Identical sequences G3WW01
ENSSHAP00000019606 ENSSHAP00000019606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]