SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000019648 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000019648
Domain Number 1 Region: 130-359
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.03e-56
Family DBL homology domain (DH-domain) 0.00000000152
Further Details:      
 
Domain Number 2 Region: 363-497
Classification Level Classification E-value
Superfamily PH domain-like 4.11e-42
Family Pleckstrin-homology domain (PH domain) 0.000000384
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000019648   Gene: ENSSHAG00000016682   Transcript: ENSSHAT00000019805
Sequence length 942
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856822.1:2288582:2304504:-1 gene:ENSSHAG00000016682 transcript:ENSSHAT00000019805 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTETETCSTHFKVKGIHYSRSEIRLGRSESLKGREEMKKSRKAENVPRSRSDVDMDAAAE
ATRLHQSASSSASSLSTRSLENPTPPFTPKMGRRSIESPSLGYCTDALLPHLLEDDLGQL
SDLEPEPDAQNWQHTVGKDVIAGLSQREIDRQEVINGTELFVTEASHLRTLRVLDLIFYQ
RMKKENLMPREELARLFPNLPELIEIHNSWCEAMKKLREEGPVINEISDLMLARFDGPAR
EELQQVAAQFCSYQSIALELIKTKQRKESRFQLFMQEAESNPQCRRLQLKDLIVSEMQRL
TKYPLLLENIIKYTDDSSSEYHKLCRARDQCREILKYVNEAVKQTENRHRLESYQKRLDT
TSLERASNPLAAEFKSLDLTTRRMIHEGPLTWRISKDKTVDLHVLLLEDLLVLLQKQDEK
LLLKCHSKTSLGSSDNKQTFSPVLKLNAVLIRSVATDKRAFFIICTSELGPPQIYELVAL
TSLDKNMWMELLEDAVQNATRNPSIVPNPSHLSQPVPQQPSQHSSSSTSMGLTDSEASQG
NGCQSEDELLPKGDRSQQWVNGKHQALLEEPEQEGSEEELVAPTSTSSLGGGGLGIRTRG
AIHLPLPSPLFMEGLADSALEDVENLRHLILWSLLPGHPIESRATVEPEDDLTPTPSVIG
ITSHPWDPGSPGQLPGEMEGNDLAPSGQMSSQLELETGELDDAALSSLEHLPPRARNSGI
WEHPELDRDVPEEPLTTEAIGGYKVVRKAEVAGSNAVPALPECGKSESEPPEAGGGPNAA
GNCFYVSMPTGPPESNTDPSDTARSFSQHEAPCASPPEPEHRGGGGDEGRARGTASSLAL
RDVGTIFRTIEQLTLKLHRLKDMETAHRELLKSLGAESSGGTTPVGGLSAEAVRWTESSP
SPPAKEPFSSCSKDSHEQGLGPETGSDSLEESPADTAISLGL
Download sequence
Identical sequences G3WW43
ENSSHAP00000019648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]