SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000019671 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000019671
Domain Number 1 Region: 141-257
Classification Level Classification E-value
Superfamily Bromodomain 1.14e-28
Family Bromodomain 0.0004
Further Details:      
 
Domain Number 2 Region: 263-394
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 6.62e-22
Family PWWP domain 0.008
Further Details:      
 
Domain Number 3 Region: 64-127
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 8.84e-16
Family PHD domain 0.0096
Further Details:      
 
Domain Number 4 Region: 1019-1062
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.0000000436
Family MYND zinc finger 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000019671   Gene: ENSSHAG00000016700   Transcript: ENSSHAT00000019828
Sequence length 1179
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834670.1:2297870:2408267:1 gene:ENSSHAG00000016700 transcript:ENSSHAT00000019828 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHPQSLAEEEIKAEQEVVEGMDISTRSKDPGSAERTAQKRKFPSPPHSSNGHSPQDTSTS
PIKKKKKPGLLNNNNKEQDGRNDFYCWVCHREGQVLCCELCPRVYHAKCLKLTAEPEGDW
FCPECEKITVAECIETQSKAMTMLTIEQLSYLLKFALQKMKQPGTEPFQKPVSLDQHPDY
AEYIFHPMDLCTLEKNVKKKMYGCTEAFLADAKWILHNCIIYNGGNHKLTQTAKVIIKIC
EHEMNEIEVCPECYLAACQKRENWFCEPCSNPHPLVWAKLKGFPFWPAKALRDKDGQVDA
RFFGQHDRAWVPINNCYLMSKEIPFSVKKTKSIFNSAMQEMEVYVENIRRKFGVFNYSPF
RTPYTPNNQFQMLLDPTNPGAGTAKTDKQEKIKLNFDMTASPKILMSKPLLSGGTGRRIS
LTDMPRSPMSTNSSVHTGSDVEQDAEKKAASSHFSASEESMDFLEKSTASPASTKTGQAG
SLSGSPKPFSPQASTPLPAAKPERASTPGSILNLNLDRSKVDMDLKELSESVQQQAAPVP
LISPKRQIRSRFQLNLDKTIESCKAQLGINEISEDVYTAVEHSDSEDSEKSDTSDSEYIS
DDEQKTKIEQEETEDKESSRTDKDSTALKKKPKPPTPVEIKEDLKSTSPPTEKSDPLVKE
KPATDPEKDFPEKVKTLPHPVKEKVKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGRE
GRKSRKESKEPPLKQEAVGKAPPPASVSSNHPPPETPVLTRSAAQTAPASVATAATTIAA
PTIATPPAATGSPVKKQRPLLPKETAPAVQRVVWNSSSKFQTSSQKWHMQKVQRQQQQQQ
QSQQGQQQQPQSSQGTRYQTRQAVKAVQQKEITQSTSTSTITLVTSTQPVSMVTSSGSSS
TLSSSLSTDLPIATASADVAADIAKYTGKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRL
RIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEKQQAVDETK
KKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKSCTQSATATQQETDPEVSTETNK
SAQPSSSAQAPQTDTATASKEKESPADKSRENVTTIPVVVSPTVGAVAMRSGAGSSGGGG
GSGGGSSSGGSGGGSASGGSSSGGVQYVQTAVPVQVRRV
Download sequence
Identical sequences G3WW66
ENSSHAP00000019671 XP_012395176.1.9362 ENSSHAP00000019671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]