SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000019682 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000019682
Domain Number 1 Region: 130-221
Classification Level Classification E-value
Superfamily PDZ domain-like 9.07e-22
Family PDZ domain 0.0000136
Further Details:      
 
Domain Number 2 Region: 21-60
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000013
Family PDZ domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000019682   Gene: ENSSHAG00000016709   Transcript: ENSSHAT00000019839
Sequence length 789
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841590.1:2301989:2373185:-1 gene:ENSSHAG00000016709 transcript:ENSSHAT00000019839 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCSLCSLQKQEEQYKLLYEVCQVNGKDLSKATHDQAVEAFKTAKEPIVVQVLRRTPRTK
MFTPSLDSQLVDMGTQTDITFEHIMALTKMASPTPPVLDPYLLPEEHSSAHEYYDPNDYM
GSIHQEMDRDELELEEVDLYRLNSQDKLGLTVCYRTDDEDDIGIYISEIDPNSIAAKDGR
IREGDRIIQINGIEVQNREEAVALLTSEESKNVSLLIARPELQLDEGWLDDDRNDFLDDL
HMDMLEEQHHQAMQFTASVLQQKKREEDEVTTDTATILSNQHEKDSGVGRTDESTRNDES
SRNDESSEQENNADDHTTSSNTLGSQRKLTYSQDTLGSGDAPFSNESFISADCTDADFLG
IPVDECERFRELLELKCQVKSANPYSLYYQNSALEVSKSDPESVDRELEMLNEELRNIEL
ECLNIVRAHKMQQLKDQYRESWMLHNSGFRNYNTSIDVRRHELSDITELPEKSDKDSSSA
YNTGESCRSTPLTLEISPDNSLRRIAENIGCQGSDGAMSASAACKASQRNLLSITESPET
SSPKYSPSPKELDLSKQLENKEKKSSDESKSPSQSPKLGGSYLSPYHHSPYKHAHIPAHA
QHYQSYMQLIQQKSAVEYAQSQMSLVSMCKDLNASNQSEPRMEWKVKIRSDGTRYITKRP
VRDRLLRERALKIREERSGMTTDDDAISEMKMGRYWSKEERKQHVVKAKEQRRRREFMMQ
SRLDCLKEQQGAEEKKEMNIIELSHKKMMKKRNKKIFDNWMTIQELLTHGTKSPDGTRVY
NSFLSVTTV
Download sequence
Identical sequences G3WW77
ENSSHAP00000019682 ENSSHAP00000019682 XP_003762415.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]