SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000019683 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000019683
Domain Number 1 Region: 68-150
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000021
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0062
Further Details:      
 
Domain Number 2 Region: 342-389
Classification Level Classification E-value
Superfamily RING/U-box 0.000000138
Family RING finger domain, C3HC4 0.019
Further Details:      
 
Domain Number 3 Region: 286-322
Classification Level Classification E-value
Superfamily SAP domain 0.0000147
Family SAP domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000019683   Gene: ENSSHAG00000016710   Transcript: ENSSHAT00000019840
Sequence length 395
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841441.1:2302366:2318612:1 gene:ENSSHAG00000016710 transcript:ENSSHAT00000019840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLVEKRAVCLGVVAQGIVDLQAGATSMWASCCGLLNEVMGTGAVRGQQSGFGGGTGPFR
FAPNTDFSTYPPAATGGANIVCKACGLSFSVFRKKHVCCDCKKDFCSVCSVIQENFRRCC
TCHLLQETSFQRPQLMRLKVKDLRQYLILRNIPIDTCREKADLVDLVLCHHGLGSEEDMD
THSLNSSRSQTSGFFTHPFFSTYPVPSSTVSSSQGDLTSQRGNSGPAALSQDKKKNTSAS
DSLCAQGQGETPSTHTEDDEENAEETPGLSRKRMRASLSDLSSLEDVEGMSVRQLKEILA
RNFVNYSGCCEKWELVERVNRLYKENEENQKSYGDKMQLNDEEDDNLCRICMDAVIDCVL
LECGHMVTCTKCGKRMSECPICRQYVVRAVHVFKS
Download sequence
Identical sequences G3WW78
ENSSHAP00000019683 ENSSHAP00000019683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]