SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000019731 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000019731
Domain Number 1 Region: 64-158
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000226
Family PDZ domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000019731   Gene: ENSSHAG00000016752   Transcript: ENSSHAT00000019888
Sequence length 170
Comment pep:novel scaffold:DEVIL7.0:GL841298.1:2327642:2328210:1 gene:ENSSHAG00000016752 transcript:ENSSHAT00000019888 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPITQDNAGLHLPLLLQWLRSNLQEAQGGPEHRLCQAAIQKLREYIQLNFAVDESTLMLD
QSPLEMEICTVYLTKEMGDMDTVGLSFGNIPVFGDYGERRRGGKKRKTRQGPVLDVGCIW
VTELKKNSPAGKCGKVKLRDEILSLNGQLMVGVDVTGARICTASQFMAEV
Download sequence
Identical sequences G3WWC6
ENSSHAP00000019731 ENSSHAP00000019731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]