SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000019935 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000019935
Domain Number 1 Region: 9-97
Classification Level Classification E-value
Superfamily PDZ domain-like 9.73e-16
Family PDZ domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000019935   Gene: ENSSHAG00000016915   Transcript: ENSSHAT00000020092
Sequence length 1652
Comment pep:known_by_projection scaffold:DEVIL7.0:GL849812.1:2408236:2627588:-1 gene:ENSSHAG00000016915 transcript:ENSSHAT00000020092 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLEPRGTDGHKLVEVLLTGGAPWGFTLKGGKEHGEPLIITKIEEGSKAAAVDKLLAGDE
IVGINDIGLSGFRQEAICLVKGSHKTLKLVVKRRNDVGCRPHSWHATKFTESHPEAISSQ
SNVCTSWHSRYHASSSSHDLSSSWDQTNLHRTSDQFSSLGSMDSLDHPSQPYSYGRLSAA
KSNSSIDHLGNPNKRDSAYGSFSTTSSTPDHTLSKADASSTENMLYKVGLWDSTKPGASK
QVQSFSDNTQSLEERLACLPSALQYENNRSPRLEENTDPKLVSSGRSSFGPVWYVPDKKK
ASSSPPPPPPPLRSDSFAATKSHEKTQSPAYSEVASTQHFIFNRSQPRSEWRLETADQPR
RMIRVSDGKRTNNAAYKPDQHLDSNWASSDDRYNNPPGSTNRLQASLSSTDVRFAQSAFG
YHHQRQYSDEQRHLAHHGGHQELPADHIQTYNPAQVRLANPASINSAADQKVENIGQSRY
YCITKKQPAQGSNQLQPLKDDYWKSVTGSEVSSGPHENLVPSTMGQKPKCHLPYCDESSG
DFSERCNSYPVDRVGESWPTGDDESHRSSHIEKANQKRVAEDFKWGEEESSKISPQKTPM
LHSLAQEGKNRSANSQDSSVEKPLPFDAQVGKPARRSDRFATTLRNEIQLRRAKLQKSRS
TVTLTGTNEEEEFADGWKPGSGQNFSTTASEGSFNNTYKDHLKEAQARVLRATSFKRRDL
EPSSSDHYSKSSPELTLDSDSASHFFDVSQTKASTSGNGMLHVPRIGGRKRFTAEQKLKS
YSEPEKIHEVGISGDLRHPCQYPSTAGEAMGSFADRWKFFEETSKPYHHRPAPKQAIYGL
PKEQTDRPGRKTYGHGGGEQWYQKRTRTSSFGENLNYTSNKVEKVGKAEQPQRLGTFAEY
QASWKEQRKPLETRSSGRYHSADDILDASLEQHEKPQYIHERSRSSPSTEHYKKEPSVGV
RRQADDSGEDRNYICSKIRTDEGNSTLRSADTEYQGESPGEKRDPLDQNLNSKLESTESS
HPREPLAVPQENRARSGTLPSDYRYSEENEKEETQDSDEPPPACSEAHGKEEDSWWVESA
SVSKKRGPAPQRPPPPKRDAVKYRHQDCSTSSAGSSAEQLLEAPSGPGPSQSPTSPDVCV
NPPVLPQSPSTFSEKLASAQPQPAPSENDCQHLNEEISDLKAEAVLSSKYRHLPKSSMES
SRSPSPQFAPQKLTDKPPLLVQDENSARIERVIDNNTTVKMVPIKIVHSESHAEKESRQN
LVSTMEPPALPSGLEKDQIKTLSTSEQSYSRFCAYTRQGVEPEAENKTQGPDSQPAEALG
YGNASTPISYMKAKEKTLEDLKSEELAREIVGKDKSLADILDPNAKIKTTMDLMEGIFPK
DEHLLEEAQQRRKLLPKVPSPKITEEKKDEQSVPSAISLTTNSTYYSTSAPKAELLIKMK
DMQEQQQQQQQIAEDSEDELDHDLSEKKQELIDSISRKLKVLREARETLLEDIQNNNALG
DEVEAIVKDVCKPNEFDKFRMFIGDLDKVVNLLLSLSGRLARVENALNNLDENTSPEEQR
TLLEKQKLLTRQHEDAKELKENLDRRERIVFDILASYLSGESLADYEHFVKMKSALIIEQ
RELEDKIKLGEEQLKCLTESLPPERAKCCMDC
Download sequence
Identical sequences G3WWY0
ENSSHAP00000019935 ENSSHAP00000019935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]